(data stored in ACNUC7421 zone)

EMBL: CP001700.PE203

CP001700.PE203       Location/Qualifiers
FT   CDS_pept        complement(219557..220213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0203"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: sma:SAV_4878 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69158"
FT                   /db_xref="GOA:C7QJ16"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ16"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69158.1"
FT                   /translation="MKESSAVRIMIAEDSAILRDGLVQILTKRGHEILAAVPNADELLA
FT                   AIAVGAPDAVVLDIRMPPTHTDEGLRAALELRRSHPKVGVLLFSQYVETRYARDLFSGQ
FT                   VSGVGYLLKERVADVSEFVEALAKIAAGGTVLDPEVVVQLLGSRPTDALTAREREVLGL
FT                   MAEGRSNAAIGKKLVLADSSVEKHISNIFTKLGLPPADEDHRRVLAVLKYLGVAP"
     atgaaggaga gcagcgcagt gcgcatcatg atcgccgaag attccgcgat cctgcgggac        60
     ggcctggtgc agatcctcac caagcgcggc cacgagatcc tggccgccgt ccccaatgcc       120
     gacgagttgt tggccgcgat cgctgtcggg gcgccggacg ccgtcgtgct cgacatccgg       180
     atgccgccga cgcacaccga cgaagggctg cgtgccgcgc tggagctgcg ccggagccat       240
     ccgaaggtcg gggtgctgct gttctcgcag tacgtggaga cccggtatgc ccgcgatctg       300
     ttcagcggcc aggtctccgg cgtcggctat ctgctcaagg agcgggtggc ggacgtcagc       360
     gagttcgtcg aggcgctggc caagatcgcc gccggcggca cggtgctcga cccggaggtc       420
     gtggtgcagc tgctcggctc ccggcccacc gacgccctga ccgcccgcga gcgcgaggtc       480
     ctgggactga tggccgaggg ccgctcgaac gccgcgatcg gcaagaagct cgtgctcgcc       540
     gacagctcgg tggagaagca catcagcaat atcttcacca agctcgggct gccgccggcc       600
     gacgaggatc accggcgggt gttggccgtg ctgaagtatc tgggggtcgc gccgtag          657
//

If you have problems or comments...

PBIL Back to PBIL home page