(data stored in ACNUC7421 zone)

EMBL: CP001700.PE204

CP001700.PE204       Location/Qualifiers
FT   CDS_pept        complement(220680..222020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0204"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   fal:FRAAL5519 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69159"
FT                   /db_xref="GOA:C7QJ17"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ17"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69159.1"
FT                   /translation="MGGGPKIGEAFPMKRFLLSPVSGRTARQYLFALVSAPLGLAGFVY
FT                   AVVTLAVGGALSFTFVGLPLIALAIHLARQYAKLQRRMARGLLGVDIEAPPPNLRRQNA
FT                   HGLLAKLGAALGDLPAWRSQLYLLVRFPLGIAYFVTLGVGVVEGLVMLTYPIWWAVFRP
FT                   TNTDSHGVKHQSALQFGDGFYFDNWLRALLLTVAGVVWIYAAVWILKFLLWLDSLLMKA
FT                   LLGPTNSERRVEELTVSRAHAVDDSAARLRRIERDLHDGAQAQLVALAMQLGEAKENLD
FT                   AGGNGAELDLTETRTLIDTAHRNAKQAINELRDLARGIHPAALDTGLRDALGTLAARSA
FT                   MPVTVNVALAERPDRAIETIAYFCAAELLTNAAKHAAPTRAALSVVQEEGQLHLTVEDD
FT                   GRGGAQVGYGGGLAGLLDRVRTVEGSLAVDSPQGGPTRVFVKLPMHV"
     gtgggcggcg ggcccaagat cggcgaagct tttcccatga agcgtttcct gttgagcccg        60
     gtgtcggggc gcaccgcacg ccagtacctg ttcgccctgg tcagcgcgcc gctcggactc       120
     gcgggcttcg tgtacgcggt ggtcacgctg gccgtcggcg gcgcgctgtc gttcaccttc       180
     gtcgggctgc cgctgatcgc cctcgcgatc cacctggccc ggcagtacgc caaactccag       240
     cgccgtatgg cccgcggcct gctcggcgtc gacatcgagg cgccgccgcc gaacctgcgc       300
     cggcagaacg cgcacgggct gctggccaag ctcggggcgg cgctgggcga cctgccggcg       360
     tggcggtccc agctgtatct gctggtgcgc ttcccgctgg gtatcgccta cttcgtcacg       420
     ctcggggtcg gcgtggtcga gggcctggtc atgctgacct atccgatctg gtgggcggtg       480
     ttccgcccga cgaacaccga cagccacggg gtcaagcacc agtcggcgct ccagttcggc       540
     gacggcttct acttcgacaa ctggctgcgc gcactgctgc tcacggtggc cggcgtggtc       600
     tggatctacg ccgcggtctg gatcctcaag ttcctgctct ggctggactc gctgctgatg       660
     aaggccctgc tgggcccgac caacagcgag cgccgggtcg aggagctgac cgtgagccgc       720
     gcgcacgccg tggacgactc cgccgcgcgg ctgcgccgga tcgaacgcga tctgcacgac       780
     ggcgcgcagg cgcagctggt cgcactggcg atgcagctcg gcgaggccaa ggagaacctg       840
     gacgccggcg gcaacggcgc cgaactggac ctgaccgaga cccgaacgct gatcgacacc       900
     gcgcaccgca acgccaagca ggccatcaac gaactgcgcg acctggcccg cggcatccac       960
     ccggcggcac tggacaccgg cctgcgcgac gccctgggca cactcgcggc gcgctcagcg      1020
     atgccggtga cggtgaacgt ggcgctggcc gagcgcccgg accgagcgat cgagaccatc      1080
     gcctacttct gcgccgccga gctgctgacc aacgcggcca agcacgccgc cccgacccga      1140
     gccgcgctgt cagtggtgca ggaggagggg caactgcacc tcaccgtcga ggacgacggc      1200
     cgcggcggcg cacaggtcgg ctacggcggc ggcctggccg gcctcctgga ccgcgtgcgc      1260
     accgtggagg gctcgctggc ggtggacagc ccgcagggcg gaccgacgcg ggtgttcgtg      1320
     aagctgccga tgcacgtgtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page