(data stored in ACNUC7421 zone)

EMBL: CP001700.PE206

CP001700.PE206       Location/Qualifiers
FT   CDS_pept        222455..224104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0206"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sgr:SGR_4708 putative acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69161"
FT                   /db_xref="GOA:C7QJ19"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030310"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ19"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACU69161.1"
FT                   /translation="MPTVAELIGVQSQHTGPGLLGPNGLRYQHPEIAAHAASRAALFGE
FT                   RHRPGMRPHIGVLLGNTDEFVFWLSAAALAGAALVGVNPTRRGAELARDIRHAECELLV
FT                   TDREHLPLLADLGLDALPLLIVDDPAYREALQPFAGVSATDVKPIAPITEDTRLLLYFT
FT                   SGSTGAPKAVTCVQGRVAASGAVMAERFGLIASDVCYIPMPMFHGNAILANWGPALVAG
FT                   ATVALRDRFSASGFLSDVREYQATYFTYVGRAISYILATPEHPEDAANPLRAGFGTEAG
FT                   PRDRERFEQRFGCHLSEGYGASEGGINIVAPRTFPPSVLARGAVVGKTNPTLSILNLET
FT                   GAPCPPAEFDAAGRLLNGAEAIGELVGTGPGGFTGYWNNPAADAERFADGRYRSGDLFY
FT                   ADTDGWLYFAARKADRMRVDGENISVALLEAILARWEPVEAVAAYAVPDEVTGDAVMCA
FT                   LVLRQGSDFDPGAFADFLAAQADLGTKMAPRFVRVTAALATTATEKVSRYAMREQGWWD
FT                   VGEDAVWARTGRQGAYQPRDTGSVNRNSAPPP"
     atgcccacgg tcgcggagtt gatcggtgtc cagtcccagc acacgggtcc cgggctgctc        60
     ggcccgaacg gcctgcggta tcagcacccg gagatcgccg cgcacgccgc cagcagggcc       120
     gcactgttcg gcgagcggca tcgtccgggc atgcggccgc atatcggagt cctgctgggc       180
     aacaccgacg agttcgtgtt ctggctctcc gccgcggcgc tcgccggggc ggcgctggtc       240
     ggcgtgaacc ccacgcgccg tggcgccgag ctggcgcggg acatccggca cgcggaatgc       300
     gagctgctgg tgaccgaccg cgagcatctg ccgctgctcg ccgatctggg tctggacgcg       360
     ctgccgctgc tgatcgtgga cgatccggcg taccgcgagg ctctgcaacc cttcgccggc       420
     gtcagcgcga cagacgtcaa gccgatcgcc ccgatcaccg aggacacccg gctgctgctg       480
     tacttcacct caggctcgac cggcgcaccg aaggcggtga cgtgcgtcca agggcgcgtc       540
     gcggcgtccg gcgccgtaat ggccgaacgc ttcgggctga tcgcctccga cgtctgctac       600
     atcccgatgc cgatgttcca cggcaacgcg atcctggcga actggggacc ggctctggtc       660
     gccggagcca ccgtcgccct gcgcgaccgc ttctcggcct ccggcttcct ctccgacgtc       720
     cgcgagtatc aggccacgta cttcacctac gtcggccgcg cgatctccta catcctggcc       780
     acccccgagc accccgagga cgccgcaaac ccgctgcgcg ccggcttcgg caccgaggcc       840
     gggccacggg accgggaacg cttcgagcag cgcttcggct gccacctctc cgagggctac       900
     ggcgcctccg aaggcggcat caacatcgtc gcgccccgca ccttcccgcc ctcggtcctg       960
     gcacgcggcg cagtggtcgg caaaaccaac ccgaccctgt cgatcctgaa cctcgaaacc      1020
     ggcgcgccct gcccgcccgc cgaattcgac gccgccggcc gcctcctgaa cggcgccgag      1080
     gcgatcggcg aactcgtcgg caccggaccc ggcggcttca ccggctactg gaacaacccc      1140
     gccgccgacg ccgaacgctt cgccgacggc cgctaccgca gcggcgacct gttctacgcc      1200
     gacaccgacg gctggctcta cttcgctgcc cgcaaggccg accgcatgcg cgtggacggc      1260
     gagaacatct ccgtggcgct cctggaggcg atcctcgccc gctgggagcc ggtcgaggcg      1320
     gtcgccgcct acgccgtacc ggacgaggtc accggcgacg cggtgatgtg cgccctggtc      1380
     ctgaggcagg gctctgattt cgaccccggg gcgttcgcgg atttccttgc cgcacaagcg      1440
     gatctgggca ccaagatggc gccgcgcttc gtccgcgtca ccgccgccct ggccaccaca      1500
     gccaccgaga aggtgtcgcg ctacgcgatg cgggagcagg ggtggtggga cgtaggggag      1560
     gacgccgtgt gggctcgtac gggccgccag ggggcttatc agccccgcga cacaggcagt      1620
     gtcaaccgga actccgcgcc gccgccctga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page