(data stored in ACNUC7421 zone)

EMBL: CP001700.PE207

CP001700.PE207       Location/Qualifiers
FT   CDS_pept        complement(224053..225753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0207"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sen:SACE_5293 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69162"
FT                   /db_xref="GOA:C7QJ20"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ20"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69162.1"
FT                   /translation="MIRGRFGRRTRLVAADQGFSAGAGTDAGAGASAGVAADASAGPNA
FT                   PFSTAPAFSAAPPTTQGSETYPARPNGQTAQSAPSALSRLGSPLSFWRRTPLRARLALA
FT                   ATVAVAAGIGGGVGFAYVAVRHSLTQQVDSGLQRQGAKVQDLLLTHHLPRYDETRSQQF
FT                   GDTLTNSQFIDSTGTPLQPKLLPATLRTPYSVVVLAPASTRVIPISSADAQVAAGSMNS
FT                   YMHSGEMNGQHVRILTLSIGQKDRALQIDAPLTAMDQQLSTLGWELFGAGAAGIVLAAG
FT                   LGWLVTRTALRPVAELTSTAERIAATHDLAHRIPIDGAPGEPRDELGRLAATFNTMLDA
FT                   VQEATDRQRQLVADASHELRTPLTSLRTNVEVLAHAQRLEPEDRQALVSGIMSGLDDMT
FT                   MLVSDTVELARGEEQAALFEELRFDLLVRRCVDRAAMHWPKAVFKEDLEDCLVVGVTDR
FT                   LAKAVRNLLDNAAKFSPDGGLVEVRTAPGADGTVTLTVRDHGPGIPEADLPHVFDRFYR
FT                   AASARDLPGSGLGLAIVAQVAVGHGGGVTVAGAQGGGAEFRLTLPVSRG"
     gtgatccggg ggcggttcgg gaggcggacg cggctcgtcg cggcggatca gggcttcagc        60
     gcgggtgcgg gtacggatgc gggtgcgggc gccagtgccg gtgtggccgc tgacgcgagc       120
     gccggcccga atgccccctt cagtactgcc cctgccttca gtgctgcccc gccgacgact       180
     cagggctcgg agacgtatcc ggcccggccc aacggccaga ccgcgcaaag cgccccctcc       240
     gccttgtccc ggctcggctc ccccttgtcg ttctggcgcc gtacgccgct gcgcgcccgg       300
     ctggcgctgg ccgcgaccgt cgcggtggcg gcgggcatcg gcggcggcgt ggggttcgcg       360
     tacgtggctg tgcggcactc gctgacgcag caggtggaca gcggtctgca acggcagggc       420
     gcgaaggtgc aggacctgct gctgacccac catctccccc gctatgacga gacccgcagc       480
     cagcagttcg gcgacacgct gaccaactcc cagttcatcg actccaccgg gacgccgctg       540
     cagcccaagc tgctgccggc gacgcttcgc acgccgtaca gcgtcgtcgt tctcgcgccc       600
     gcctcgacca gggtgatacc gatctcctcg gcggacgccc aggtcgccgc cgggagcatg       660
     aacagctaca tgcattccgg cgagatgaac ggccagcacg tccgcatcct gaccctgtcg       720
     atcggccaga aggaccgggc cctgcagatc gacgcgccgc tgaccgcgat ggaccagcag       780
     ctgtccacgc tgggctggga gctgttcggc gcgggcgcgg cgggcatcgt cctggccgcg       840
     ggtctgggct ggctggtcac ccgtaccgcg ctgcgtccgg tcgcggagct gaccagtacc       900
     gccgagcgca tcgccgccac gcacgacctc gcgcaccgca tcccgataga cggtgcgccc       960
     ggggagccgc gcgacgaact cggccgcctg gccgcgacgt tcaacaccat gctggacgcg      1020
     gtccaggagg ccacggaccg gcagcgccag ctggtcgccg acgcctcgca cgagctgcgc      1080
     acgccgctga cctcgctgcg caccaacgtc gaggtgctgg cgcacgcgca gcgtttggag      1140
     ccggaggacc ggcaggcgct ggtgtccggc atcatgtccg ggctcgacga tatgaccatg      1200
     ctggtcagcg acaccgtcga gttggcgcgc ggcgaggagc aggcggcgct gttcgaggag      1260
     ctgcggttcg acctgctggt gcggcggtgc gtggaccgcg ctgcgatgca ctggccgaag      1320
     gcggttttca aggaggatct ggaggactgt ctggtcgtcg gggtcaccga ccggctggcc      1380
     aaggctgtgc gcaacctgct ggacaacgcg gccaagttct cccccgacgg cgggctggtc      1440
     gaggtgcgga ccgcacccgg cgcggacggc acggtcacct tgacggtccg cgaccacgga      1500
     ccgggtatcc ccgaagccga tcttccgcat gtcttcgacc gcttctaccg cgccgcgagc      1560
     gcccgtgatc tgccgggttc ggggctgggg ttggcgatag tggcccaggt cgcggtcggg      1620
     cacggcggcg gggtgacggt cgccggggct cagggcggcg gcgcggagtt ccggttgaca      1680
     ctgcctgtgt cgcggggctg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page