(data stored in ACNUC7421 zone)

EMBL: CP001700.PE208

CP001700.PE208       Location/Qualifiers
FT   CDS_pept        complement(225750..226466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0208"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: fre:Franean1_5311 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69163"
FT                   /db_xref="GOA:C7QJ21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ21"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69163.1"
FT                   /translation="MDTRGSLDREPRSLLVVDDDTEIRDAIARAFRLQGYRVRTASGGL
FT                   AALEQVAADPPDAIVLDVMMPELDGVEVCRRLRGVGDHTPVLLLTARDAVGDRVAGLDA
FT                   GADDYLVKPFALAELHARMRALLRRSEYDPVPESERLVFEDLELDPESRLAYRGGRTIE
FT                   LTRTEFALLELLMRNAGRVLPREVISDRIWGYELGPESNSLEVFVSCIRRKTEGGGEPR
FT                   LVQTVRGFGYTLRVPA"
     atggacaccc gaggctccct agaccgagaa ccgcgcagcc tgctggtcgt cgacgacgac        60
     accgagatcc gtgacgcgat cgcacgggcc ttccgcctgc agggctatcg cgtgcgcacc       120
     gcttccggcg gcctggccgc cctggagcag gtcgcggccg acccgccgga cgcgatcgtg       180
     ctggacgtga tgatgcccga gctcgacggg gtggaggtgt gccggcgcct gcgcggcgtc       240
     ggcgaccaca ccccggtgct gctgctgacc gcgcgcgacg cggtcgggga ccgggtggcc       300
     gggctcgacg ccggcgccga cgactacctg gtgaagccgt tcgcgctggc cgagctgcac       360
     gcccggatgc gcgcgctgct gcgccgctcc gagtacgacc cggtgcccga atccgagcgc       420
     ctggtgttcg aggacctgga gctggacccc gagtcccggc tggcctaccg cggcgggcgc       480
     acgatcgagc tgacccgcac cgagttcgcg ctgctggagc tcctgatgcg caacgcgggg       540
     cgggtgctgc cccgggaagt gatctccgac cggatctggg gctacgaact cgggccggag       600
     tcgaactccc tggaggtgtt cgtgtcctgc atccggcgca agacggaggg cgggggagag       660
     ccccggctgg tgcagacggt gcgcggcttc gggtacacgc tgcgggtgcc ggcgtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page