(data stored in ACNUC7421 zone)

EMBL: CP001700.PE209

CP001700.PE209       Location/Qualifiers
FT   CDS_pept        complement(226478..227143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69164"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ22"
FT                   /inference="similar to AA sequence:KEGG:Acel_1453"
FT                   /protein_id="ACU69164.1"
FT                   /translation="MSDKPGGPAANDNNAEFELLSQAPSAPDISGQLKPARSGGAGIPK
FT                   VTLGLVGAVLLAGGFVGGIAVGKSNSSSSSKPSNTAAGANRARGGYGGGFGTGGATGGA
FT                   AGGTAGGATGGAAGGARGGAVTGTVTAVSGSTITVTDSTGKAVTVNTSPQTTVTIGKSG
FT                   AVSDLTTGSEVTILGTPDSSGTITARSVVSGITQFGFGGRGGNRTPGAASSSPGGSNG"
     atgtctgaca agcccggcgg cccggccgcc aacgacaaca acgcagagtt cgagctcctg        60
     tcccaggcgc cctcggcgcc ggacatcagc ggccagctca agcccgcccg cagcggcggc       120
     gccggcatcc cgaaggtgac cctgggcctg gtcggcgcgg tgctgctggc cggcgggttc       180
     gtcggcggga tagcggtggg caagagcaac agctcctcgt cgtccaagcc ctcgaacacc       240
     gccgccggcg cgaaccgcgc gcgcggcggc tacggcggcg ggttcggcac cggcggggct       300
     accggcggcg cggccggcgg gacggccggc ggagccacgg gaggcgcggc cggcggtgcc       360
     cggggcggag ccgtcaccgg caccgtcacc gccgtcagcg gctcgaccat caccgtcacc       420
     gacagcacgg gcaaggcggt gaccgtgaac accagcccgc agaccaccgt cacgatcggc       480
     aagagcggcg cggtctcgga cctgacgacc ggctccgagg tgacgatcct gggcactccg       540
     gacagtagcg ggaccatcac ggcgcgctcc gtggtgagcg gaatcaccca gttcgggttc       600
     ggcggacgcg gcggaaaccg cacgccggga gccgcgtcgt cttcgccggg tgggtcaaac       660
     gggtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page