(data stored in ACNUC7421 zone)

EMBL: CP001700.PE21

CP001700.PE21        Location/Qualifiers
FT   CDS_pept        complement(22500..23396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0021"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: fal:FRAAL6347
FT                   putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68976"
FT                   /db_xref="GOA:C7QFN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68976.1"
FT                   /translation="MVHGRGHTVGMSPARSVLAEELGRRLRRHRLDLGLSGLEVAARAG
FT                   VTQPSVSKIERGMMLPSTEVLERVLGVLGLADEHRTDLRDLLTRAVDDAADRRRHGRGL
FT                   ALLDAIAERERNTTALRSFSTSMIPPLLQTADYARYAARLTPWMSERELGRASALHLER
FT                   QGVLFEQGRSFEFLLTESALRLCPGPPTLAATQADRLRVLSALPGVRIGIVPDSAAVSE
FT                   VFPLYGFTLHDDAAVAVETFTGELLLSRADEIAAHAAVLDGYAAGADYDLETATGLLTS
FT                   DRRPLASIPAPAGAGTG"
     atggtccacg gtcgcggcca cactgtgggg atgagcccag cacgcagcgt attagctgaa        60
     gaactcggtc ggcgtctgcg tcggcaccga ctggacctcg gcttgtccgg actcgaagtc       120
     gccgcccgcg ccggtgtcac ccagccctcg gtgtcgaaga tcgaacgcgg catgatgctc       180
     ccctccaccg aggtgctgga gcgcgtgctc ggcgtcctgg gcctggccga cgagcaccgc       240
     accgacctgc gcgacctgct cacccgggcg gtcgacgacg ccgccgaccg ccgccggcac       300
     ggccgcggcc tggcgctgct ggacgcgatc gccgagcgcg agcgcaacac cacggccctg       360
     cggtcgttct ccacctcgat gatcccgccc ctgctgcaga ccgccgacta cgcccggtac       420
     gccgcgcgcc tgacgccgtg gatgtcagag cgcgaactcg gccgcgcctc cgccctgcac       480
     ctggagcgcc agggcgtgct gttcgaacag ggacgcagct tcgagttcct gctcaccgag       540
     agcgccctgc gcctgtgccc gggtccgccc acgctcgccg cgacccaggc cgaccggctg       600
     cgcgtgctct cggcgctgcc cggcgtgcgg atcggcatcg tcccggactc ggccgcggtc       660
     tcggaggtgt tcccgctgta cgggttcacg ctccacgacg acgcggccgt ggccgtggaa       720
     accttcaccg gcgagttgct gctctctcgc gccgacgaga tcgccgcgca cgccgcggtc       780
     ctcgacggct acgcggccgg cgccgactac gacctggaga cggccaccgg acttctcacg       840
     agtgacaggc gcccgctggc gtctatcccg gcgccggccg gggcaggaac cggctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page