(data stored in ACNUC7421 zone)

EMBL: CP001700.PE210

CP001700.PE210       Location/Qualifiers
FT   CDS_pept        complement(227177..228406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0210"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   saq:Sare_0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69165"
FT                   /db_xref="GOA:C7QJ23"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ23"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACU69165.1"
FT                   /translation="MRFREVFRFAFAGLKANKLRSGLTTLGILIGVGAVILLVAVGKGS
FT                   GAQVQANIDKLGTNLLEVSRQAGGFGARASRNTGTQSSVSALTLADAQSLVDPVNAPDV
FT                   LTEAPVVTASPTATYSGATHQISQLVGTYPAYLQATNWQIAEGSSITDDDVTQARKVIV
FT                   IGQTVATDLFGTADPVGQQVMINNVPYSVEGVLQSKGSSGLQDADDFAIAPLTTVQDSL
FT                   SGFGSLSQIVVQAKSAGATTAAQNEITSILTSRHHLSATASPDFRVLNQQSLLATSSST
FT                   THTFTVLLGAVAAISLLVGGIGITNIMLVTVTERTREIGIRKALGAPRAAILGQFLIEA
FT                   VMLSLIGGALGVAAGLIGTRFTVAGVKPVIVPASIALAFAVSALIGLFFGSFPANRAAK
FT                   LHPIQALRHE"
     atgagattcc gcgaggtctt ccggttcgcc ttcgccgggc tgaaggccaa caagctgcgc        60
     tcggggctga ccaccttggg catcctgatc ggcgtcggcg cggtgatcct gctggtcgcg       120
     gtcggcaagg gctccggcgc gcaggtgcag gcgaacatcg acaagctggg gacgaacctg       180
     ctggaggtct cccggcaggc cggcggcttc ggcgcgcgcg cctcccgcaa caccgggacg       240
     cagagctctg tctcggcgct caccctggcc gacgcgcagt cgctggtcga cccggtgaac       300
     gccccggacg tgctgaccga ggcgccggtg gtcaccgcct ccccgaccgc gacgtattcc       360
     ggtgccacgc accagatctc gcagctggtc ggtacctacc cggcctacct gcaggcgacc       420
     aactggcaga tcgccgaagg ctcctcgatc accgacgacg acgtgaccca ggcccgcaag       480
     gtcatcgtga tcggccagac ggtggccacc gacctgttcg gcaccgccga cccggtcggg       540
     cagcaggtca tgatcaacaa cgtcccctac agcgtggagg gcgtgctgca gtccaagggc       600
     tcctcgggcc tgcaggacgc cgacgacttc gccatcgcgc cgctgaccac cgtgcaggac       660
     tcgctgagcg gcttcgggtc gctgagccag atcgtggtgc aggccaagtc cgccggcgcc       720
     accaccgcgg cgcagaacga gatcacctcg atcctgacct cgcggcacca cctgtcggcg       780
     acggcctcgc cggacttccg ggtgctgaac cagcagtcgc tgctggccac ctccagctcc       840
     accacgcaca ccttcacggt cctgctgggc gcggtcgcgg ccatctcgct gctggtcggc       900
     gggatcggga tcaccaacat catgctggtc accgtgaccg agcggacacg ggagatcggc       960
     atccgcaagg ccctgggcgc gccgcgcgcg gcgatcctgg gccagttcct catcgaggcg      1020
     gtgatgctgt ccctgatcgg cggcgccctg ggggtggccg ccggactcat cggcaccagg      1080
     ttcacggtcg ccggggtgaa accggtcatc gtgcccgcct cgatcgcgct ggccttcgcg      1140
     gtgtcggcgc tgatcgggct gttcttcggg tcgttcccgg ccaaccgcgc ggccaagctg      1200
     catcccatcc aggcactgcg gcacgagtag                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page