(data stored in ACNUC7421 zone)

EMBL: CP001700.PE211

CP001700.PE211       Location/Qualifiers
FT   CDS_pept        complement(228406..229176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0211"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: saq:Sare_0222 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69166"
FT                   /db_xref="GOA:C7QJ24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU69166.1"
FT                   /translation="MTGVSGPGGSEGRKPVIELADIRKTYGMDGTAVHALRGVTLTVPA
FT                   GDYVAIMGASGSGKSTMMNIIGCLDVPTSGRYLLDGIEVEHLSDRQLALVRNRKIGFVF
FT                   QSFNLLPRTTALDNVELPLIYAGVGTAERRKRARAALELVGLGDRMNHKPQELSGGQQQ
FT                   RVAVARALVTAPSLILADEPTGNLDSASSEDVMALFDRLHQAGRTIVLITHEHDIAEHA
FT                   DRAIRLMDGQIVSDERNGARGWLSAQHSAKHGSA"
     gtgaccggcg tgagcggtcc gggcggatcg gagggccgca agccggtcat cgagctcgcc        60
     gacatccgca agacctacgg catggacggc accgccgtcc atgccctgcg cggcgtcacc       120
     ctgaccgtcc cggccgggga ctacgtcgcg atcatgggcg cctcgggctc gggcaagtcc       180
     acgatgatga acatcatcgg ctgcctggac gtccccacct ccggccgcta cctgctggac       240
     ggcatcgagg tcgagcatct gtcggaccgc cagctcgcgc tggtccgcaa ccgcaagatc       300
     ggcttcgtct tccagtcctt caacctgctg ccgcgcacca ccgcgctgga caacgtggag       360
     ctgccgctga tctacgccgg cgtcggcacc gccgagcggc gcaagcgggc cagggccgcc       420
     ctggagctgg tgggtctcgg cgaccggatg aaccacaagc cgcaggagct ctccggcggc       480
     cagcagcagc gcgtggccgt ggcccgcgca ctggtcaccg cgccgagcct gatcctggcc       540
     gacgagccca ccggcaacct ggacagcgcc tcctccgagg acgtgatggc cctgttcgac       600
     cggctgcacc aggccgggcg caccatcgtc ctgatcaccc acgagcacga catcgccgag       660
     cacgccgacc gcgcgatccg gctgatggac gggcagatcg tctccgatga gcgcaacggc       720
     gcccgcggct ggctttccgc acagcacagt gccaagcacg ggagcgcttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page