(data stored in ACNUC7421 zone)

EMBL: CP001700.PE212

CP001700.PE212       Location/Qualifiers
FT   CDS_pept        complement(229173..230783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0212"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ace:Acel_1450 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69167"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ25"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACU69167.1"
FT                   /translation="MTDSPRLPKGVWINTSLAVVVAAGGAGAWALLGSSSSDKTAANGR
FT                   TIAVQRGNVTAQVSASGNVTLPTEQDLAFTASGTVTEVDVKPGDVVKAGQVLAKIDTTE
FT                   ANQQLTSAQAQLTTAQAQLTKLQQGQTPQQAALSRQQLTNAADSLSSAKTSYSDARNSI
FT                   SLDESNLAAAVTTAKNNLAADEAAAKPDAAKIAQDTNAVTQAENAQKNGSLKDTQSLHQ
FT                   AQNSLTSAQNSYAIAVDQQAVSAAPATPDQIASANQSVLNAQNAVTTAQKGVAGTVITA
FT                   PQAGTVLSVGGLVGDSVSAGSASSTSAASSSSGGSTGGSSGGSASGSSGSSSSSTSSTA
FT                   AKSGSSFVVLGNMSSLTVRAEFAETDAAKLKPGESAQVTINAIPGSALTATVQSVDPTS
FT                   TVVSNVVEYGVTLQFTAGQQDLASLKPGQTASVSVTTDSVTNVLYVPSSSVTTLAGQSF
FT                   VTIVSGKTQTQTPVQIGVVGDTSTEITSGVSEGDEVLLSSRTTTGTGTTTRGGGAGGFG
FT                   GGAGGFGGGAAGGRGGFGG"
     atgaccgata gcccgcgact ccccaaaggg gtctggataa acacctcgct cgccgtggtg        60
     gtagccgccg gcggagcggg cgcctgggcg ctgctcggct cgtcgagttc cgacaagacc       120
     gccgccaacg gccgcaccat cgcggtgcag cggggcaacg tcaccgccca ggtctcggcc       180
     tccggcaacg tgaccctgcc gacggagcag gacctcgcgt tcaccgcgtc gggcacggtg       240
     accgaggtcg acgtgaagcc cggcgacgtg gtgaaggccg gccaggtgct ggcgaaaatc       300
     gacaccaccg aggcgaacca gcagctgacc tccgcccagg cccagttgac caccgcgcaa       360
     gcgcagctga ccaaactgca acagggccag acgccgcaac aggcggccct gagccggcag       420
     cagctgacga acgccgcgga ctcgctgtcg tcggcgaaga cctcgtactc cgacgcgcgg       480
     aacagcatct cgctggacga gagcaatctg gccgccgcgg tcaccacggc gaagaacaac       540
     ctcgccgccg acgaggccgc ggcgaaaccg gacgccgcga agatcgcgca ggacaccaac       600
     gccgtcaccc aggccgagaa cgctcagaag aacggctcgc tgaaggacac gcagtccctg       660
     caccaagcgc agaactcact gacgtcggcg cagaactcct acgccatcgc cgtggaccag       720
     caggcggtct ccgccgcgcc ggccaccccg gaccagatcg cctcggccaa ccagtccgtg       780
     ctcaacgccc agaacgcggt caccaccgcg cagaagggcg tcgccggcac cgtcatcacc       840
     gcgccgcagg ccgggacggt cctgtcggtc ggcggtttgg tcggcgactc ggtgagcgcc       900
     ggatccgcgt cctccacctc ggcggcgtcc tcgtcctccg gcggttctac tgggggttcc       960
     tctgggggtt cggcaagcgg ctcctcggga tcgtccagct cctcgacgtc ctccaccgct      1020
     gccaagtccg gcagcagttt cgtggtgctg ggcaacatgt ccagcctgac ggtgcgcgcc      1080
     gagttcgccg agaccgacgc cgccaagctc aagcccgggg agagcgcgca ggtcacgatc      1140
     aacgcgatcc cgggctcggc gctcaccgcg accgtgcagt ccgtcgaccc gacctcgacc      1200
     gtggtgtcca acgtcgtcga gtacggcgtc acgctccagt tcaccgccgg gcagcaggat      1260
     ctggcctcgc tcaagcccgg acagaccgcg tcggtctcgg tcaccaccga tagcgtgacc      1320
     aacgtgctct acgtgccgtc ctcttcggtc accacgctgg ccggccagag cttcgtcacc      1380
     atcgtcagcg gcaagaccca gacgcagacg ccggtccaga tcggcgtggt cggcgacacc      1440
     tcgacggaga tcacctccgg ggtgagcgag ggcgacgagg tgctgctgtc ctcgcgcacc      1500
     accaccggca ccggcaccac cacccggggc ggcggcgcgg gtggcttcgg cggcggcgcg      1560
     ggcgggttcg gcggcggcgc cgccggcggc cggggcggat tcggcgggtg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page