(data stored in ACNUC7421 zone)

EMBL: CP001700.PE213

CP001700.PE213       Location/Qualifiers
FT   CDS_pept        230930..231601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_0266 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69168"
FT                   /db_xref="GOA:C7QJ26"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69168.1"
FT                   /translation="MPKIDWTPGQGKRGRPLRRVLGMGQQQGLLVMYGLAAIAVVLALA
FT                   AACGAFDGSGPQPSAQTAGESTNPDDPAGAPSIPKDSTKSTQILLGSVQHYADLLASGQ
FT                   KIVGTTHYPDMAAYAQAFADASSPAARFSKFRTSPNPESDTTYLNAERQAAAAYGGDHG
FT                   SRLDAWLRDMAKVKSDLGDWVATAAQYQQGAANQAVLDAAASTVNQDLATARDAANSLS
FT                   H"
     gtgccgaaga ttgactggac tccggggcag ggcaaacgcg gccggccgct gcgccgggtg        60
     ctgggcatgg ggcagcaaca gggcctgctg gtgatgtacg gcctcgcggc gatagccgtc       120
     gtgctcgcgc tggccgcggc gtgcggcgcc ttcgacggct ccggcccgca gccgtccgcc       180
     cagaccgccg gcgagagtac gaaccctgac gacccagccg gcgcgccctc gatccccaag       240
     gattcgacga agagcaccca gatcctgctc ggctcggtcc agcactacgc ggacctgctg       300
     gcctccggcc agaagatagt cggaaccacg cactaccccg acatggcggc ctacgcccaa       360
     gccttcgccg acgcctcgtc cccagccgcg cgcttctcca agttccgcac ctcgccgaac       420
     cccgagagcg acacgacgta tctgaacgcc gaacgccaag ccgccgcggc ctacggcggc       480
     gaccacggca gccgcctcga cgcctggctg cgcgacatgg cgaaggtcaa gtccgacctg       540
     ggggactggg tcgccaccgc cgcgcagtac cagcagggag cggcgaacca ggcagtcctg       600
     gacgcggcgg cgtcgaccgt gaaccaggac cttgcgacgg cccgggacgc cgcaaactcg       660
     ctgagccact ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page