(data stored in ACNUC7421 zone)

EMBL: CP001700.PE214

CP001700.PE214       Location/Qualifiers
FT   CDS_pept        complement(231644..232222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0214"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mab:MAB_2246 thiol-specific antioxidant related
FT                   protein/peroxidoxin BcpB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69169"
FT                   /db_xref="GOA:C7QJ27"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ27"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACU69169.1"
FT                   /translation="MHDIYTLPADLPIPQDDGAADHLPGARVPELTLTSTAGEAIALAA
FT                   LGEGRTVLYIYPLSGRPGEEAPEGWSAIPGARGCTTEACDFRDHHKELLEAGAARVFGL
FT                   SSQDSAYQQELVERLRLPFAMLSDTGLRLAAELDLPTFEAGGRLLYKRITLVIRDGVIE
FT                   HAFYPIFPPDRHAGEVLGWLTKNPVRRIP"
     gtgcacgaca tctacacgct ccccgccgac ctgccgatcc cgcaggacga cggcgccgcc        60
     gaccatcttc ccggcgccag ggttccggag ctcaccctga ccagcaccgc cggcgaggcg       120
     atcgccttgg ccgcgttggg ggagggccgt acggtgctct acatctaccc gctgagcggt       180
     cggcccggcg aggaggcgcc cgagggctgg agcgcgattc ccggtgctcg gggctgtact       240
     acagaagcct gcgattttcg cgaccatcac aaggaactgc tcgaggccgg tgcggcgcgg       300
     gtgttcggct tgtccagcca ggacagcgct tatcagcagg agttggtcga gcggttgcgg       360
     ctgcccttcg cgatgctgtc cgacaccggg ctgcgcctcg ccgccgagtt ggatcttccg       420
     acgttcgaag ccggagggcg tctcctctat aagaggatca ctcttgtcat ccgtgacggc       480
     gtgatcgagc acgccttcta tccgatcttt ccgccggacc gccatgccgg cgaagtgctg       540
     gggtggctta cgaagaatcc cgtacgccga atcccgtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page