(data stored in ACNUC7421 zone)

EMBL: CP001700.PE215

CP001700.PE215       Location/Qualifiers
FT   CDS_pept        complement(232341..233099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sco:SCO7301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69170"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ28"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACU69170.1"
FT                   /translation="MVKAFRPDDVVRVDGDVHAVLGSDVTWVVVKDGDAATLIDTGYPQ
FT                   DYDNLLASLALLGVAPESLSAILITHAHNDHIGGAERLRSTYGIPVLTHAEEVPHARRD
FT                   FLDQVSIGKVAANAWRPGVVPWALRALRSGGTADVPVAEPQAFPADGPLDLPGAPIPLH
FT                   TPGHTEGHCAYLLPAAGILVCGDALGTGHPTSRISGPQMLPTMFQKDRARALASLSVFE
FT                   GIDADVLVPGHGPVHRGAMRDVVQRVRERG"
     atggtcaaag ccttccgtcc ggacgacgtc gtgcgcgtcg acggcgacgt gcacgcggtg        60
     ctcggcagtg atgtgacgtg ggtcgtggtg aaggacggcg atgccgcgac gctgatcgac       120
     accggttatc cgcaggacta cgacaacctt ctggcgtcgt tggcgctgct cggcgtggcg       180
     ccggagtcgt tgagcgcgat tctgatcacg cacgcgcaca acgatcacat cggtggcgcc       240
     gagcggctgc ggtcaacgta tgggattccg gtcctgacgc acgccgagga ggtgccgcac       300
     gcgcggcggg atttcctgga ccaggtgtcg atcgggaagg tggcggcgaa cgcctggcgt       360
     ccgggggtcg tgccgtgggc actgcgggcg ctgcgcagcg gtggcacggc ggacgtgccg       420
     gtggccgagc cgcaggcctt tcccgccgac gggccgctcg acctgcccgg ggcgccgatc       480
     ccgctgcaca ctcccgggca caccgaaggg cactgcgcgt atctgttgcc ggctgccggg       540
     atcctggtct gcggggacgc gctgggcacc gggcatccga catcgcggat cagcggaccg       600
     cagatgctgc cgaccatgtt ccagaaggat cgggcgcgcg cgctggccag cctcagcgtt       660
     tttgagggga tcgacgcgga cgtgctggtc cccgggcacg gtccggtaca ccgcggcgcg       720
     atgcgggacg tcgtccagcg agtgcgggag cgcgggtag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page