(data stored in ACNUC7421 zone)

EMBL: CP001700.PE216

CP001700.PE216       Location/Qualifiers
FT   CDS_pept        complement(233220..235211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0216"
FT                   /product="cell wall binding repeat 2-containing protein"
FT                   /note="KEGG: ace:Acel_1461 cell wall binding repeat 2-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69171"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ29"
FT                   /inference="similar to AA sequence:KEGG:Acel_1461"
FT                   /protein_id="ACU69171.1"
FT                   /translation="MSSPRIRSTAGSLAAAALLTLGATAYAPQASATGLPHHAARNGPI
FT                   TWAMNGPGVTGVDPVTGASIPGALVPALSSLNGTLSDLAWSPDGTKIAAVLTHGSNQQR
FT                   ALIAYSLIDQTVTTVEDGIPMLADPSWTADGSTILFAAAGGAQRNGLEVLWAISPVAGA
FT                   VEHRLLPNEPNCQEIEPSAGPGGAVVFTRTPYLTCDGGNGIGYSVNGHTTVIGQAQDFH
FT                   PALSPDGRTIVYCHQDVATGYYQLYRSAIVNGVPQPGTPLPGSPTMVTGDLVFSPDGSA
FT                   VAFHVFTGTGPQLATMPVAGGNPVYLSWPGASTGRLSWQPLFDKDVVRLYGDSRLATAV
FT                   SASRYTWADNGTADPARKQAKAAVISRSDNYADALGGAVLAARAGGPLLLTPTGTLDPA
FT                   VRAELDRILPAGAPVYVLGGGAAVSQTVENQLAGRYTVRREAGADRFATAVAVARASLA
FT                   LTPPSAGRVHVLAATGLNYPDALSAGAAAGALGTGVVVLTSDGQLPEVTRRFLADPTGT
FT                   GAAVDVDTIGGQAGSAIPDTSDVRLPAGSIVSAYSGTDRYETSYRVASVLLGDRQPTTA
FT                   GIVTAANWPDALAGGALLGVLRGPLLLYPSVPTSPTSLTDKWLRSNAATLRSVLILGGP
FT                   SALAPSTQRLIQGDIAAPGRSVYTENPY"
     ttgtcctccc ccagaatccg atcgacggcc gggtccctgg ccgccgccgc gctcctgacg        60
     ctcggcgcga ccgcttatgc gccccaggcc tccgccaccg gtctgccgca ccacgccgcc       120
     cgaaacggtc ccatcacatg ggccatgaac ggcccgggcg tcaccggagt cgatccggtc       180
     acgggcgcct ccatcccggg cgccttggta cccgcgctca gctccctgaa cggcacactc       240
     agcgacctgg catggtcgcc ggacgggacc aaaatcgcag ctgtcctgac ccacggctcg       300
     aatcagcagc gggccctgat cgcctactcg ctcatcgacc agaccgtcac cacggtcgaa       360
     gacggcatcc cgatgctggc cgatccttcg tggacggcgg acggttcgac gatcctgttc       420
     gccgccgccg gcggcgcgca gcgcaacggg ctggaggtgc tctgggcgat cagcccggta       480
     gccggcgccg tcgagcaccg gctcctgccc aatgagccga attgtcagga gatcgagccc       540
     tccgccggtc ccggcggcgc cgtcgtcttc acccggacgc cgtacctgac ctgcgacggg       600
     ggcaacggca tcggctattc cgtcaacggg cacaccaccg tcatcggcca agcgcaagac       660
     ttccaccccg cgctgtcccc ggacggcagg accatcgtgt actgccacca ggacgtggcg       720
     accggctact accagctcta ccggtccgcg atcgtcaacg gggtcccgca gcccggaacc       780
     ccgcttcccg gctcgccgac catggtcacc ggggatctgg tgttctcccc cgacggatca       840
     gccgtcgcct tccacgtctt caccggcacg ggcccgcagc tggcgacgat gcccgtcgcc       900
     ggcggcaacc cggtctacct gagctggccc ggcgcttcca cgggccggct gagctggcag       960
     ccgctgttcg acaaggacgt ggtccggctc tacggggaca gccgtctggc caccgcggtc      1020
     agcgcctccc gctacacctg ggccgacaac ggcaccgccg acccggcccg caagcaggcc      1080
     aaggcagccg tcatcagccg gtcggacaac tacgccgacg ctctcggcgg cgccgtcctg      1140
     gccgcccgcg ccggcggtcc gttgctgctc acgcccaccg gcaccctgga ccccgcggtg      1200
     cgggccgaac tcgaccgcat cctgccggcc ggcgctccgg tctacgtcct cggcggcggc      1260
     gcggcggtgt cccagaccgt cgagaaccag ctcgccggcc gctacacggt acggcgcgag      1320
     gccggcgccg accgcttcgc caccgcggtc gccgtcgccc gggcctcgct cgcgctgacg      1380
     ccgccctcgg cggggcgggt ccatgtcctg gccgcgaccg gcctcaacta tccggacgcg      1440
     ctgtccgcag gcgccgccgc cggcgcgctg ggcaccggcg tggtggtcct gacctcggac      1500
     ggccaactgc ccgaggtgac gcgccgcttc ctcgccgacc cgacgggcac cggcgccgcc      1560
     gtcgacgtcg acaccatcgg cggccaagcc ggctcggcga tcccggacac gtccgacgtg      1620
     cggcttccgg ccgggtcgat cgtgtcggcc tactcaggca cggaccgcta cgagacctcc      1680
     taccgggtgg ccagcgtcct gctgggcgat cggcagccga ccacggcggg catcgtcacc      1740
     gccgcgaact ggccggacgc cctggccgga ggcgccctgc tcggcgtcct gcggggaccg      1800
     ctgctgctgt atccctcggt cccgacctcc ccgacctccc tcaccgacaa gtggctccgg      1860
     tcgaacgccg ccaccctccg ctcggtgctg atcctcggcg gtcccagcgc gctggcgcct      1920
     tcgacgcaac gcctgatcca gggcgacatc gcggcgcccg gcaggtcggt ctacacggag      1980
     aacccctact ag                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page