(data stored in ACNUC7421 zone)

EMBL: CP001700.PE217

CP001700.PE217       Location/Qualifiers
FT   CDS_pept        complement(235340..237394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0217"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69172"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ30"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69172.1"
FT                   /translation="MSCPVLCLVVSLKDVSVPKPRAIRLATLAITGAALLVAGAAPALA
FT                   AGPGGRFGVSASASSAPAMSLSFGFYAGTSHAAAVLYAFNVDPAKEATTTYRIDWGDGS
FT                   TPWVQTGGTVPNGLVISHDYPHAGVWKATATVDDGTSTVGQNTTYTAHYPTTPTTPGSA
FT                   FTPVGGNAPLAGDLSIDGGTVDAAATKSYIVNWGDGSPSQTVAAADSGPTVVHHVFTAP
FT                   RSYGVSVVTTDGIDSSAPPLYPTAVSAWGLAFSSTVNTTAFATVTVTSSAGKSLPTYSD
FT                   YYMFSVNWGDGTTSPATQSEDMTHQYKTGGPYAVTVTMAPTMDADKSPAYTWTAGTTLV
FT                   VPTPPPPAPPAVGTRLVQRLGGLDRIGTGITVSRSGWSSWQNRFPYGGQLPAGAVVLAR
FT                   SDGFSDALAGVPLAAHVNGPLLLTGGSALDLTVEHEITRVLQPHAGKTVYLLGGTAALS
FT                   PAVQQRLVQLGYTVQRYSGLDRFGTALDIARRGLNDPAKIVVATGMDYPDALAAGPYAS
FT                   SVLGTSGHEAAVVLSQGGTLDPATAGYISSRLNSSSAQAPTVVTVGGAAGHAVDAAFPA
FT                   LAGHELKLQGQNRYQTANAVASQFTSASRVGVATGTGYADALTGGALAAARHFPIVLTT
FT                   PAGLDPAGREAIARFWSQLSGAYLFGGTTALSDQVLRDVDAVVNATAQP"
     atgagctgcc ctgtgctctg tctcgtcgtc agcctcaagg atgtctctgt gccgaagcca        60
     cgtgccatac gactcgcgac gctcgcgatc accggcgccg ccctgcttgt cgccggggcc       120
     gccccggcac tggccgccgg gcccggcggc cggttcggcg tctcggcgag cgcctcctcc       180
     gctcctgcga tgtccctctc gttcgggttc tatgccggga cgtcgcatgc ggccgcggtg       240
     ctctacgcgt tcaacgtcga tccggcgaag gaagcgacca ccacgtatcg gatcgactgg       300
     ggcgacggaa gcacaccgtg ggtccagacc ggtgggacgg tgccgaacgg cctggtcatc       360
     tcgcacgact acccgcacgc cggggtctgg aaggcgacgg cgacggtgga cgacgggacg       420
     tccaccgtcg gtcagaacac cacgtacacc gcgcactatc cgaccactcc caccacgccg       480
     gggtccgctt tcacacctgt cggcgggaac gcgccgctgg ccggggatct gagcatcgac       540
     ggcgggaccg tcgacgccgc cgccacgaag agctacatcg tgaactgggg cgacgggtcg       600
     ccgtcgcaga cggtcgccgc ggctgattcc gggcccaccg tggtgcacca cgtgttcacc       660
     gcgccgcggt cctatggcgt gtccgtggtg accaccgacg gcatcgactc ctcggcgccg       720
     ccgctgtatc cgaccgctgt cagcgcctgg ggtctggcgt tctccagcac ggtgaacacc       780
     accgcgttcg cgacggtgac cgtcacctcc tccgccggca agagcctgcc gacgtacagc       840
     gactactaca tgttctcggt caactggggc gacggcacca cctcgccggc cacccagtcg       900
     gaggacatga cgcaccagta caagaccggc gggccctacg ccgtcacggt gaccatggcg       960
     ccgaccatgg acgcggacaa gtcgcccgcc tacacctgga ccgccggcac gacgctggtc      1020
     gtgcccacgc cgccgccgcc cgccccgccg gccgtaggca cgcgcctggt gcagcgcctg      1080
     ggcggtctgg accgcatcgg caccgggatc accgtctccc ggagcggctg gagcagctgg      1140
     cagaacagat tcccctacgg cggtcagctc cccgccggcg ccgtcgtgct ggcccggtcc      1200
     gacgggttct ccgacgccct ggccggcgtc ccgctggccg cgcacgtcaa cggcccgctg      1260
     ctgctgaccg gcggcagcgc gctggacctg accgtcgagc acgagatcac cagggtgctg      1320
     caaccccatg ccggcaagac cgtctacctg ctgggcggta ccgccgcgct ctccccggcg      1380
     gtccagcagc ggctcgtcca gctcggctac acggtccagc gctattccgg cctcgaccgg      1440
     ttcggcacgg cgctggacat cgcgcggcgc ggcctgaacg acccggccaa gatcgtcgtc      1500
     gcgaccggta tggactatcc ggacgcgctg gctgccggac cgtatgcgtc ctcggtcctg      1560
     gggacgtcgg gtcacgaggc ggccgtcgtc ctgtcccagg gcggcaccct ggatcccgcc      1620
     accgcggggt acatcagctc ccgtctgaac tcctccagcg cgcaggcacc gaccgtcgtc      1680
     accgtgggcg gcgccgccgg gcacgcggtc gacgcggcgt tccccgcctt ggccggccac      1740
     gaactcaagc tgcagggtca gaatcgctat cagaccgcga acgcggtcgc gtcgcagttc      1800
     acttccgcct cgcgcgtcgg cgtggcgacg ggcaccggct acgcggacgc gctgaccggc      1860
     ggcgccctgg ccgccgcccg gcacttcccg atcgtcctca ccaccccggc gggcctggac      1920
     ccggcgggac gcgaggcgat cgcacgcttc tggtcgcagc tgtccggcgc ctacctgttc      1980
     ggcggcacga cagcgctgag cgaccaggtc ctgcgggacg tcgacgcggt cgtcaacgcg      2040
     acggcgcagc cgtga                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page