(data stored in ACNUC7421 zone)

EMBL: CP001700.PE218

CP001700.PE218       Location/Qualifiers
FT   CDS_pept        237642..240188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0218"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; KEGG: ace:Acel_1679
FT                   protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69173"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ31"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACU69173.1"
FT                   /translation="MPFLAANARADTVAATVFVGSTSGAPCSDTAAAAGSAATPFCAIQ
FT                   PAIDSPLTGPGTTVLVAAGAAYLGQVNLDKSGTSADPIVLRSASPAQGSRAVIRGTVSV
FT                   NGAHDVTVDGFDIYADTFGVNIEASSDVVVTRDHIEGPHDSSVADSGIMIAMASSAVTV
FT                   STDFVRGFGGGGLFADSVSGLNIVADTITRNTTPSAGLDSIEVTGTSSGVAVADDIIDA
FT                   APSLPAGSAVDYNVIDAGAVGPHDITGDGLAGSTDGDITPGDTSPAIDSAEEAATGELP
FT                   TDMFGNAAADDPLVPNAGTGSRVRDRGAVERTHGDTSYVLTLTPASGDAPLAVTATVTE
FT                   HVGWAQQPRAAFYSFGFGGTEQPATANPTARHTYTTPLYGGDVSVTIYDSAHEAIGYTT
FT                   ALVNVGQPVHATLSVAAASGLNVNAVGSVQGGVGDWSIDFGDGYSTNFYSQTQATANHS
FT                   YAKPGTYKVTLTANGILPSNAAKLTQQVTVTAPPAPPPIVDTDPLVHRIAGSDRYATSI
FT                   VASQVRWSAANSVDGAPAEDQAQAVVLARGDAFPDALAGVPLAAYKHGPLLLTDPKTVS
FT                   QATLEEIRRVLPAGGNHTIYILGGKTAVSPSVEAELRGLGYNVVRYGGTDRYGTALLIA
FT                   HLGLGDPRHLIIAIGGDFADALAAGPFAADSAEVVDGKPAAILLSGKANGNDTITDAGT
FT                   AAYIDAKVQSNGGLSHCTDPNLITAVGGPALTAFLNQEHKATKYACVDGIVGADRYATS
FT                   SQLAGQWTNPEHPGVAVGTTFPDALSGGAYEASLGQPLLLTNPTSLPSSTATALASMYP
FT                   PHENTRTRSVVIFGGTSAVSSAVENQIIAKVHGRAQ"
     gtgcctttcc tcgccgcgaa cgcccgcgcc gacacggtcg ccgcgacagt gttcgtcggg        60
     tcgacgagcg gtgctccgtg cagtgacacc gccgccgcag caggatccgc ggcgactccg       120
     ttctgtgcca tccagccggc gatcgactca cccctgaccg gaccggggac gacggtcctc       180
     gtcgctgccg gcgccgccta cctcgggcag gtgaatctgg acaagtcggg cacgtccgcc       240
     gatccgatcg tcttgcgctc cgcgtcgccg gcgcagggca gtcgcgctgt catcaggggc       300
     accgtttccg tgaatggggc gcacgatgtc accgtcgacg ggttcgacat ctacgccgac       360
     accttcgggg tcaacatcga ggcatcctcg gacgtcgtcg tcacccgcga ccacatcgaa       420
     ggtccccatg actcgagtgt cgcggactcc ggcatcatga tcgcgatggc atcgtcggcg       480
     gtcacggtca gcaccgactt cgtcaggggt ttcggtggcg gaggcctgtt cgcggactct       540
     gtgtccgggc tgaacatcgt cgccgacacc atcacgcgca acacgacgcc gagcgccggg       600
     ctggactcga tcgaggtgac cggaacgtcc agcggagtcg ctgtcgccga cgacatcatc       660
     gacgctgcgc cgtccttgcc ggccgggtcc gccgtcgact acaacgtgat cgacgccggc       720
     gccgtcggcc cgcacgacat caccggcgac ggtctggccg ggagcaccga cggtgacatc       780
     acgccgggcg acacctcgcc ggcgatcgac tccgctgaag aggcggctac cggcgaactg       840
     ccgaccgaca tgttcgggaa cgcggctgcc gacgatccgc tggttcccaa cgccggcacc       900
     ggatcacgcg tccgggaccg cggcgccgtg gagcggacgc acggcgatac gagttacgtc       960
     ctcaccctca ccccggcatc cggcgacgcc ccgctcgcgg ttaccgccac cgtcaccgag      1020
     cacgtcggct gggctcagca gccgcgcgcg gccttctact ccttcggctt cggcgggacc      1080
     gagcagccgg ccaccgccaa cccgacagcg cggcacactt acacgactcc gctctacggc      1140
     ggcgacgtat ccgtcacgat ctacgacagc gcccatgagg ccatcggcta tacgacagcg      1200
     ctcgtcaacg tcggccagcc ggttcacgcc acgctctccg tcgccgcggc ctccggtctg      1260
     aacgtcaacg ccgtcggcag cgtccaaggc ggcgtcggcg actggtccat cgacttcggc      1320
     gacggatact cgacaaactt ctacagccag acgcaggcca ctgcgaacca ctcctacgcg      1380
     aagcctggaa cctacaaggt caccctgacc gcgaacggaa tcctgccctc caacgccgcg      1440
     aagctcaccc agcaggtgac ggtcacggcg ccgcccgccc cgccgccgat cgtggacacg      1500
     gacccgctcg tccaccgcat cgccggctcc gaccgctacg cgacgtcgat cgtcgcctcc      1560
     caggtccggt ggagcgccgc gaacagcgtc gacggcgccc cggcggagga tcaggcccag      1620
     gccgtcgtgc tcgcccgagg cgacgcgttc cccgacgccc tcgccggcgt cccgctcgcc      1680
     gcgtacaagc acggtccgct gcttctcacg gacccgaaga ccgtgagcca ggcgaccctt      1740
     gaggagatcc gccgcgtcct gccggccggc ggaaaccata cgatctacat cctcggcggc      1800
     aagacagccg tgtcgccgtc cgtcgaggcg gagctccgcg gcctcggcta caacgtcgtc      1860
     cgctacggcg gcacagaccg gtacggcacc gcactcctga tcgcccacct cggcctcggg      1920
     gatcccagac acctgatcat cgcgatcggc ggagacttcg ccgacgccct cgccgccgga      1980
     cccttcgcag ctgacagcgc cgaagtcgtc gacggcaaac cagccgcgat cctcctgtcc      2040
     ggcaaggcga acggaaacga caccatcacc gacgccggca cagccgcata catcgacgcc      2100
     aaggtccagt ccaacggcgg cctcagccac tgcaccgacc ccaacctcat caccgcagta      2160
     ggcggcccag ccctcaccgc cttcctgaac caggaacaca aggcaacgaa atacgcctgc      2220
     gtcgacggca tagtaggcgc cgaccgctac gcaacctcca gccaactagc cggccaatgg      2280
     accaaccccg aacaccccgg agtagcagtc ggcacaacct tccccgacgc actcagcggc      2340
     ggcgcctacg aggccagcct cggccaaccc ctactcctca ccaacccaac ctcgctaccc      2400
     agctcaacag ccaccgcact agcctcgatg tacccgccac acgaaaacac ccgcacccgc      2460
     tcggtcgtga tcttcggcgg cacttcagcg gtgagcagcg ccgtggagaa ccagatcatt      2520
     gcgaaggtcc acggtcgcgc ccaatag                                          2547
//

If you have problems or comments...

PBIL Back to PBIL home page