(data stored in ACNUC7421 zone)

EMBL: CP001700.PE219

CP001700.PE219       Location/Qualifiers
FT   CDS_pept        complement(241285..242544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0221"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: sma:SAV_347
FT                   IS256 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69174"
FT                   /db_xref="GOA:C7Q0A6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7Q0A6"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACU69174.1"
FT                   /translation="MILKEEDPMTALTSVPAGDDFERQLAAAEPDVLRAMVKSFAEALM
FT                   SAEADAACGAPYGQVSADRTNSRNGYRTRAWDTRVGSIELAVPKLRTGSYFPEWLLERR
FT                   RRAEQALMSVVATAYLLGVSTRRVERLAAELGVTQLSKSQVSAMAKHLDEQVAAFRNRP
FT                   LDAGPYPVLWIDALTQKVRENGRVVNVHALVAVGVNGDGGREILGIDVASAEDGAGWLA
FT                   FLRSLTARGLAGVQLVISDAHRGLVESIGAAIGGATWQRCRTHYARNLMNQVPKTAQPW
FT                   VATLLRTIFEQPDAEAVHAQAGQVIAALEAKFPKAAAHLDEARADLLAFTAFPHEIWRQ
FT                   IWSNNPQERLNKEIRRRTDVVGIFPDRASVIRLVGAVLAEQNDEWAEGRRYMGLEILAK
FT                   IQRTGQGPAPDTAPAAALIA"
     atgatcttga aggaagagga cccgatgacc gctttgacca gtgtgcctgc cggtgacgac        60
     ttcgagcggc aactcgccgc ggccgagccg gacgtgttgc gggcgatggt gaagtcgttc       120
     gctgaggcgt tgatgtcagc cgaggccgac gcagcctgtg gcgcgcccta tggccaggtc       180
     agcgccgatc gcaccaactc ccgcaacggc taccgcaccc gggcgtggga tacccgggtg       240
     ggcagcatcg agctggcagt gcccaagctg cggaccggct catacttccc ggagtggctg       300
     ttggagcggc gtcgccgggc cgagcaggcg ctgatgtcgg tggtcgccac ggcgtatctg       360
     ctgggcgtct ccacgcggcg ggtggagcgg ctggccgccg aactcggggt gacgcagctg       420
     tccaagtcac aggtgtcggc gatggccaag cacttggatg agcaggtcgc cgccttccgt       480
     aaccgtccgc tggacgcagg gccgtatccg gtgctgtgga tcgacgccct gacccagaag       540
     gtgcgggaga acggccgggt ggtcaacgtg cacgccctgg tcgcggtcgg ggtcaacggc       600
     gacggcggcc gggagatcct gggcatcgac gtggcctcgg ccgaggacgg cgccggctgg       660
     ctggcgttcc tgcgctcgct gaccgcccgc ggccttgccg gggtgcagtt ggtcatctcc       720
     gacgcgcacc gcggcctggt ggagtccatc ggcgccgcga tcggcggtgc cacctggcag       780
     cgctgccgca cgcactacgc caggaatttg atgaaccagg tccccaagac cgcccagccc       840
     tgggtggcca cgctgctgcg caccatcttc gagcaacccg acgccgaggc cgtgcacgcc       900
     caagccggcc aggtcatcgc cgcattggag gcgaagtttc ccaaggccgc cgcacacctg       960
     gacgaggccc gggccgacct gctggccttc accgccttcc cccacgagat ctggcggcag      1020
     atctggtcca acaacccgca ggaacgactg aacaaggaga tccgccgccg caccgacgtc      1080
     gtcggcatct tccccgaccg cgcctcggtg atccggctag tgggcgccgt gctggccgag      1140
     cagaacgacg aatgggccga gggccgccgc tacatgggac tggaaatcct ggctaagatc      1200
     cagcgcacag gccaaggccc cgccccggac acagcaccag cggccgccct gatcgcctaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page