(data stored in ACNUC7421 zone)

EMBL: CP001700.PE22

CP001700.PE22        Location/Qualifiers
FT   CDS_pept        23568..24164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0022"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   sco:SCO2347 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68977"
FT                   /db_xref="GOA:C7QFN8"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN8"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ACU68977.1"
FT                   /translation="MSLTALLTAFGVVFLAELPDKTAIASLILGARYRPSWVFAGVAAA
FT                   FVVHVALAVAAGSLLTLVPRRPLEAIVAVLFLGGAVLMLRSHGREAGEEEAEEAPDLGD
FT                   DAGFGKVAGTAFGVIMVAEFGDLTQIVTANLAAKFADPLAVGLGATLGLWAVGGLAIVG
FT                   GRSLLKVLPLHLIVRLAALVMVVLAGVSLWQAVAG"
     atgagcctga ccgccctgct gaccgcgttc ggcgtggtgt tcctggccga actgccggac        60
     aagaccgcga tcgcgtccct gatcctgggc gcccggtacc ggccgtcctg ggtgttcgcc       120
     ggggtggcgg cggccttcgt ggtgcacgtc gcgctcgccg tcgcggccgg ctcgctgctc       180
     accctggtcc cgcggcgtcc gctggaggcc atcgtcgcgg tgctgttcct cggcggcgcg       240
     gtgctgatgc tgcgcagcca cggccgcgag gccggtgagg aagaggccga agaagccccg       300
     gacctcggcg acgacgccgg tttcggcaag gtggccggga ccgcgttcgg ggtgatcatg       360
     gtcgccgagt tcggggacct gacacagatc gtgaccgcga acctggcagc gaagttcgcc       420
     gatccgctcg ccgtcggcct cggcgccacc ctgggtttgt gggcggtcgg cggactggcc       480
     atcgtcggcg ggcgcagtct gctcaaggtg ctgccgctgc acctgatcgt gcggctggcg       540
     gcgctggtga tggtcgtgct ggccggcgtc agcctgtggc aggccgtcgc cggctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page