(data stored in ACNUC7421 zone)

EMBL: CP001700.PE220

CP001700.PE220       Location/Qualifiers
FT   CDS_pept        complement(242678..244198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cms:CMS_1496 large integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69175"
FT                   /db_xref="GOA:C7QJ33"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69175.1"
FT                   /translation="MTHFQSATPPTASGSHSTPPTPGWLSVGAERADPQDCSEGGCVGD
FT                   YSAPTDLFCRKHDRFLPLSSRLPSRRKTIAINLSRLVVLGGFEYSAQYATNVPLVVLGA
FT                   VLGGLLLVLPLRRFPHTYAAAVRAWAVGGLVCGLAAIPDVTLHRVLGTAVLVIVLGGAT
FT                   LYLGRLASLIGVGDPRIPDQIAPRRAARQHAGRQAALGTPGRVAGLVVGPAVASPAAIL
FT                   TLLALGQGPAQWLFRAPSAIQVFLVTTAIGGPVATLFIAAVAGFLEGAPKVDRQVAPKF
FT                   PEPFAPPRFVLDTVPDGSLGRVASRTVEITVNAVRRAAHVLATSTVRTANWMHRHAVII
FT                   GRKVAATAQCALGILRNAAVIAGYAAMCAVRIVVLPAVGIGAAYALLVPSGSALTRYLL
FT                   SGGFADLGLGIAGAIALAASVMLVWMLLSGLSRDRVLDSATHNVEDLWARVMVLIATGG
FT                   LALGTLGSLGYGKIHIGFVTLSVDAVVAFTVLKGYARTSIPWRRNVTK"
     atgacccact tccagtcggc aacgccgccg accgcgtcag ggtcgcactc caccccgccc        60
     actccgggct ggctgagtgt gggtgccgag cgtgccgacc cgcaggactg ctcggaaggc       120
     ggatgcgtcg gcgactacag cgcgccgacg gacttgttct gccgcaagca cgaccggttc       180
     ctgccgttgt cctcgcggct gcctagccgc cgcaagacca tcgcaatcaa tctcagtagg       240
     ctggttgttc tgggcgggtt cgaatacagc gcgcagtacg ccaccaacgt tcctcttgtc       300
     gtgctcggcg ccgtgctcgg cgggctgctg ctcgtcctac cgcttcggcg cttcccgcac       360
     acgtacgcgg ccgccgtgcg ggcgtgggcg gtcggaggcc tcgtctgcgg actggccgcg       420
     atccccgacg tgacgctgca ccgagttctg ggtacagccg tgctggtgat cgtgctcggc       480
     ggggcgacct tgtacctcgg ccggctggcg tcgctgatcg gagtcgggga tccgcggata       540
     cccgaccaga tcgcgccccg tcgtgcggcc aggcaacatg ctggacggca ggctgcactc       600
     ggcaccccgg gccgggtcgc cggtctggtg gtcggtccgg ccgtcgcctc cccggctgcg       660
     atcctgacgc tgttggcgct gggtcaagga ccggcgcagt ggctgttccg ggcgccgtcg       720
     gcgatccagg tgttcctggt gacgaccgcg atcggcggcc cggtggcgac gctgttcatc       780
     gccgccgtcg ccggcttcct ggaaggtgcc ccgaaggtcg acagacaggt cgcaccgaag       840
     ttccccgagc ctttcgcgcc gccgcgcttc gtgctggaca ccgttccgga cggcagcttg       900
     ggccgcgtgg cgtcccggac ggtagagatc accgtgaacg cggtccgccg cgccgcacac       960
     gtcttggcca cgagcacggt gcgcaccgcg aactggatgc acaggcacgc agtcatcatc      1020
     ggccggaagg tggccgccac cgcgcagtgc gccctcggca tcctgcggaa cgcggcggtc      1080
     attgccgggt acgcggcgat gtgcgccgtg cggatcgtgg tgctgcccgc cgtgggaatc      1140
     ggcgctgcct atgctctgct cgtgcccagc ggttcggcgc tgacccgata cctgttgtcc      1200
     ggtggtttcg ccgacctcgg cctcggcatc gccggcgcca tcgcgctcgc ggcctcggtg      1260
     atgctcgtgt ggatgctcct cagtgggctg tctcgagacc gcgtgctcga ctcggcgacc      1320
     cacaacgtcg aggacctctg ggcgcgggtg atggtgctga tcgcaaccgg cggcctcgct      1380
     ctggggacat tgggcagcct ggggtacggc aagatccaca tcggcttcgt gaccctttcc      1440
     gtggacgcag tcgtcgcgtt caccgtcctg aagggctatg cgcgcacctc cataccctgg      1500
     cggaggaatg tcacgaaata g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page