(data stored in ACNUC7421 zone)

EMBL: CP001700.PE221

CP001700.PE221       Location/Qualifiers
FT   CDS_pept        complement(244269..246128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69176"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69176.1"
FT                   /translation="MNQASVHSVLDQLARLGPLRVAFLSGAGVSVEMPTGLPSGAALTR
FT                   RVCEAFFPERTFDTLLDYHAAVGWTITEVCAAQRARAGGIAPKGRLPRLETVLGVAMRV
FT                   LDHDERRVLRILDDVRTAVPNRQHAALAAHLAVGGRQLTLNFDDCIEQRLITLEAPPDA
FT                   ADRLIHLHSSFRADPEGRSLGLTLARIEPGFQKPVEHSLTSTLAAAAAIVVVGYSGSDF
FT                   FDVDQTVAALPSGSLKGTRLYWINHGSHPRWHVIDAANPALPPVIAGLARAGARPTVLC
FT                   GRTGEFLSSLLDAWRLNSGPEPAVSAGPPAPPPTVPVSENERREAALALYRELAIPRAV
FT                   AGILDSGNLAGLPSDAVWLARSELLWEQGRWNDLLHQWLRRTPEGIDPLVRAERVGACL
FT                   WVQGRLVPAYLWLVAHRRAAAVDPDGARRLAETEGRVVEHMARTPELRPIARCLAPQAV
FT                   GRIRALGGLEQQAGVHAFRRRQDLTSSLDAIGGGGVREAGHAAASQNWFAEAGSLTAAL
FT                   SYRHRQLRDEFRPDRPDEELAADYRELADRFDIVGSAAGRVRTCLLPGAERVFGVREFV
FT                   SALFDGQFGWWHRCRLLGHYLPSRVGHIARSALTIRQGRDPRL"
     atgaaccagg cttcagtgca ctcggtattg gatcagctgg cccggctggg accgcttcgc        60
     gtggcattcc tgagcggcgc gggcgtctcg gtggagatgc cgaccgggct accgtccgga       120
     gccgcgctga cgcgccgcgt ctgtgaggcg ttcttccccg agcgcacgtt cgacacgctg       180
     ctcgactacc acgcggccgt cggctggacc atcacggaag tctgcgccgc gcaacgggcc       240
     agggccgggg gaatcgcccc caagggccgc ctgccccgcc tggaaaccgt gctcggcgtc       300
     gcgatgcggg tgctcgatca cgacgaacgc agagtccttc ggatcctcga cgacgtacgt       360
     acagcagtcc ccaaccggca gcacgccgca ctcgccgcgc acctggccgt cggcggccgc       420
     cagctgacgc tgaacttcga tgattgcatt gaacagcggc tgatcacgct cgaggcgccc       480
     cccgacgccg cggaccggct gattcacctg cacagctcgt tccgcgccga ccccgagggc       540
     cgcagcctgg gcctcaccct ggcccggata gagcccggct tccagaaacc cgttgagcac       600
     tccttgacct cgacgctcgc ggccgccgcg gcgatcgtcg tcgtcggcta cagcggcagc       660
     gacttcttcg acgtcgacca gacggtcgcc gcactgccgt cgggctcgct caagggcacc       720
     cgcctgtact ggatcaacca cggctcgcac ccccgctggc acgtcatcga cgccgccaac       780
     ccggccctgc cgccggtgat cgccggtctg gcgcgagccg gggctcgacc gacagtgctg       840
     tgcggccgga ccggtgagtt cctcagctcc ctgctcgacg cctggcgtct gaactcgggt       900
     ccggagcccg cggtgtccgc cggccctccg gcaccgccac cgaccgtccc ggtgtccgag       960
     aacgaacgcc gcgaagcggc gctggcgctc tatcgggaac tggcgatccc ccgcgccgtc      1020
     gcggggatcc ttgactccgg caatctcgcc ggtctgccgt cggacgccgt ctggctggcc      1080
     cgctcggagc tcctgtggga gcagggccgc tggaacgacc tcctgcacca gtggctgcgc      1140
     cgaacaccgg aggggatcga cccgctcgtc cgggccgaac gcgtgggcgc gtgtctctgg      1200
     gtgcagggac ggctggtccc cgcctatctg tggctcgtcg cgcaccggcg cgccgcggcg      1260
     gtggacccgg acggtgcccg acggctcgcg gagaccgaag gccgcgtcgt cgagcacatg      1320
     gcccggacgc cggagctgcg gccgatcgcc cggtgcctgg cgccgcaggc ggtcggccgt      1380
     atccgggcgc tgggtggtct ggagcagcaa gcgggcgttc acgcgtttcg ccggcgccag      1440
     gatctgacgt ccagtctcga cgcgatcggc ggcggcggcg tcagggaagc cggacacgcg      1500
     gcggcctcac agaactggtt cgccgaggcc ggcagtctca ccgcggcgct gagttaccgc      1560
     caccggcagc tccgcgacga gttccgcccc gaccgacccg acgaagaact ggccgccgac      1620
     taccgcgagc tcgccgaccg gttcgacatc gtcggatcgg ccgccggccg ggtgcggacc      1680
     tgtctgctgc cgggcgccga gcgggtgttc ggggtccggg agttcgtctc ggcgctgttc      1740
     gacgggcaat tcggctggtg gcaccggtgc cggctgctcg ggcactacct gccgagccgc      1800
     gtcggccata tcgcccgcag cgcactgacc attcggcagg ggcgtgatcc aaggctctga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page