(data stored in ACNUC7421 zone)

EMBL: CP001700.PE222

CP001700.PE222       Location/Qualifiers
FT   CDS_pept        complement(246125..246994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69177"
FT                   /db_xref="GOA:C7QJ35"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69177.1"
FT                   /translation="MTGHRRSPAHDATQRDQLHTHSGHLARIGRDIRDGRGLEGYAVFV
FT                   TGLTMTVLGLTDAVSAPIMGAAQLLAISFLVFHSITPNRHRAVDVLAGREAFAPFPSLL
FT                   PHARDLRIYGPTAINVVVHLAEIRRLVLARGGMVRIVVQKPDPIQLRHTAVQLDQGLDL
FT                   DQTLTAAIRSLERCDGLPGFGYRLLPFNPGFSLVVVNAGDKDGYVIVEPHGFGDQAISD
FT                   RMHLRITRSESPRWFAYWVDRFDAIWAASSDGEHASSGAKPGTDGETRSEGRLGSLSQP
FT                   DAEQGVAG"
     gtgaccgggc accgacgttc gccagcccat gatgccaccc agagagatca actgcacacc        60
     catagtggcc atctggcgcg gatcgggcgc gacatcagag acgggcgggg actggagggc       120
     tatgcggtct tcgtcacggg actgacgatg accgtgctcg gcctcaccga cgcggtcagc       180
     gctcccatca tgggcgccgc gcagctgctc gcaatctcgt tcctggtctt ccacagcatc       240
     acgccgaacc ggcaccgggc ggtggacgtc ctggccggcc gggaggcctt cgcgccgttc       300
     ccatcactgc tccctcatgc ccgggatctg cggatctatg gcccgactgc gatcaacgtc       360
     gtcgtgcatc tggcagagat ccggcggctg gtgctggccc gcggcggcat ggtgcggatc       420
     gtggtgcaga agccggatcc gatccagctg cgacacaccg cggtacaact ggaccaaggc       480
     cttgatcttg accaaacgct gaccgccgcg atccgcagcc tggaacgctg cgacggcctc       540
     cccgggttcg gctaccgcct gctgcccttc aaccccgggt tcagcctggt cgtcgtcaac       600
     gccggcgaca aggacgggta cgtcatcgtc gagccgcatg gcttcggcga ccaggccatc       660
     agcgaccgga tgcacctgcg catcacccgg agcgaatcgc cgcgatggtt cgcctactgg       720
     gtcgatcggt tcgacgcgat ctgggcggcg tcctcggacg gggagcacgc gagttccggc       780
     gctaagccgg gcaccgacgg tgaaacccgc tccgaagggc gtcttggatc cctctcgcag       840
     cccgacgccg aacagggcgt ggccggatga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page