(data stored in ACNUC7421 zone)

EMBL: CP001700.PE223

CP001700.PE223       Location/Qualifiers
FT   CDS_pept        247117..249495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0225"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; NB-ARC domain
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sen:SACE_0488 SARP family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69178"
FT                   /db_xref="GOA:C7QJ36"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ36"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69178.1"
FT                   /translation="MCGSAGTVGGDVDANREIAAQLKSWRERRHLSQANLADRINVSRS
FT                   HYTRLERGERPLHPVLADALDKALDTGGLFQNLREGSAADPSQHRSSDAASPGESSDRG
FT                   PFVPFPNTVHFTGRADEVQAVCQTLTGQLGHPRAAGICVISGMPGIGKTALARCVAHLL
FT                   ADRFPDGCLCLDLQGFAPGVTPLTDFDALGLVLAMLGVPDEQIPAGRQARVVRYHREIA
FT                   GRRLLLLLDDAVCAQQISCLMPPTAGCSVLVTSRNRLTALDDAHRVVLPVLPPEQAAEL
FT                   FCAVAEYRGGDQTSIDGILAACGGVPLALRIVAARCRPDSGLTPADLAARLAHPRSRLT
FT                   HLADNERAVSDAFGASLDLLPSAQRRLFLLLGLHPAKPLSGWAAAALADIPAEQAERGL
FT                   EELVGASLLEPRGHGRFRVHDLLAEFAASAVRRELPATEIWAATGRMLDAYAVTAEAAD
FT                   RLLTPYRHRLSATEGAATGSPPQTFEDDEHARSWLTDHLDTLSALCVLAATDGWDERSW
FT                   QLAYSLRGVFFLGRHWRLWRATHEAALPAAVRAGNRIGTGMTLANLGFVLGETHDFEAA
FT                   MTHLGAAVEVFRDIGDRHGEFTAQSHLAWIQHCTGDYREALAGQTAALEFRQAVGTPRN
FT                   VAIIMRDMAATELALGKHGEARDHLQTAVAMFTELGLRLDLTMALNGLGELAVHEGDTL
FT                   QADVHHYAALNAARRSGSVFEQARAHAGLGRCAVRRGRPARARHQLTRALRLYDTLGAG
FT                   HVAAAVHAELAALDGAGISAARTRTPGTPSAPSAPGQTR"
     atgtgcggat ccgccggaac agttggggga gacgtggatg cgaatcgtga aatagcggcg        60
     cagctgaagt cgtggcgcga gaggcggcat ctcagccagg cgaacctggc cgaccggatc       120
     aacgtctccc gctcgcacta cacccgcctt gaacgaggcg aacggccgct acacccggtg       180
     ctggccgacg cgctcgacaa ggctttggac accggcgggc tgttccagaa cttgcgtgag       240
     ggatcggcgg ccgacccctc acagcaccga agctccgacg cggcgtcacc gggcgagtcg       300
     tccgatcgcg ggcccttcgt cccgttcccg aacaccgtgc acttcaccgg ccgggccgat       360
     gaggtccagg ccgtgtgcca aacgctgacc gggcagctcg gccatccccg cgcggcgggg       420
     atctgcgtca tcagtggcat gccggggatc ggcaagaccg cgctggctcg atgcgtcgcg       480
     cacctgctcg ctgaccgctt cccggatggc tgcctgtgcc tggacctgca gggattcgcc       540
     cccggggtga cgccgttgac cgacttcgat gcgctcggcc tggtgctggc gatgctgggc       600
     gtgcccgatg agcagatccc ggcgggacgg caggcgcgcg tcgtccgcta tcaccgggag       660
     atcgccggac ggcggctgct gctcctgctc gatgacgccg tgtgcgctca gcagatcagc       720
     tgcctgatgc cgccgacagc cggttgctcg gtcctggtca ccagccgcaa ccggctgact       780
     gctctcgacg acgcgcaccg ggtggtactg cctgtgctgc caccggagca ggcagctgag       840
     ttgttctgcg ccgttgccga gtatcgcggc ggcgatcaga cctcgatcga cggcattctg       900
     gcagcgtgcg gcggggttcc gctcgcgctg cggatcgtgg ccgcccggtg tcgtcccgac       960
     agcggtctga caccggcgga cctggcggcg cggttggcgc atccccggtc gcggctcacc      1020
     catctcgccg acaatgagcg ggctgtctcc gatgccttcg gcgcctcact ggacctgctt      1080
     ccttccgcac agcgccggct gttcttgctg ctcggcctgc atccggcgaa accgctgagc      1140
     ggctgggcgg ccgccgcgct cgccgacatt cccgccgaac aagccgagcg cgggctggag      1200
     gaactggtcg gagccagcct gctggagcct cgtgggcacg gccgcttccg agtccacgac      1260
     ctgctagcgg agttcgcggc ttcggccgtc cggcgggaac tcccggcgac ggagatttgg      1320
     gcggcgacgg ggcggatgct ggacgcgtac gcggtcaccg ccgaggcggc cgaccggctg      1380
     ctcaccccct accgccaccg tctttcagcg actgagggcg ccgcgaccgg atcaccgccg      1440
     cagaccttcg aagacgacga acatgcgcgg agttggctta ctgatcatct cgataccctc      1500
     agcgcgctgt gcgtgctcgc cgccaccgac ggctgggacg agcggtcgtg gcagctggcc      1560
     tactccctgc gcggagtctt cttcctcggc cggcactggc ggttgtggcg tgccacgcac      1620
     gaggcggcgc tgcccgctgc ggtccgggcg ggaaaccgca tcggcaccgg catgaccttg      1680
     gccaacctcg gtttcgtgct gggcgagacg cacgacttcg aggcggccat gacccacttg      1740
     ggtgccgctg tggaggtgtt ccgggacatc ggcgacagac acggcgagtt cacggcgcaa      1800
     tcccacttgg cctggatcca gcactgcacc ggtgactacc gggaagccct ggccgggcag      1860
     acggccgcgc tggagttccg gcaggccgtc gggacgccgc gaaatgtggc gatcatcatg      1920
     cgcgacatgg ccgcgaccga gctcgccctg gggaagcacg gcgaagcccg cgaccacctc      1980
     cagaccgcgg ttgcgatgtt caccgagttg ggactgcgcc tggatctgac gatggcgctc      2040
     aacggcctcg gcgaactcgc cgtccacgag ggcgacaccc tccaggccga cgtccaccac      2100
     tatgcagcgc tgaacgccgc ccggcgctcg ggcagcgtct tcgagcaggc ccgtgcgcac      2160
     gctggactgg ggcggtgcgc cgtccgccga ggccgcccgg cgcgcgcgcg gcaccagctg      2220
     accagagcgc tgcgacttta cgacacattg ggtgccggcc atgtcgcggc cgccgtgcac      2280
     gccgaactcg ccgcgttgga cggtgccggg atctccgcag cgcgtacccg cacgccgggc      2340
     acgcccagtg cgccgagcgc tccgggacag acgcgatga                             2379
//

If you have problems or comments...

PBIL Back to PBIL home page