(data stored in ACNUC7421 zone)

EMBL: CP001700.PE224

CP001700.PE224       Location/Qualifiers
FT   CDS_pept        249492..250529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_5148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69179"
FT                   /db_xref="GOA:C7QJ37"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69179.1"
FT                   /translation="MSPQKTGVPPGEFDIFLSLGGPDRVEANLLKEALVKEGLTVFIDE
FT                   DDIRHFDGITREIERCLRSSRALLAYYSREYPLRSACQFELTAALLAGRNEQDPTRRII
FT                   VVNPEATEDHIQPAYISDARFAVRPGSDHERKALAALIKQKVDTLEGPLSSIAFTRRPR
FT                   WFAFRIAGAPGFVGRYRELWELDSLLTKAALPLTQDTPFGPVAVVTGAARVGKSSLVAD
FT                   YAWQFGAAFRGGVYWIDMSGVEGTADQVLAAYADRVRSSAAIAGLDVAGLSRERMFGVL
FT                   GDHLAATAEPSLWIVDGLPAGLGEQAPHRMIIPAGDRVQTVFVGRRDPFGGAIRAMVLG
FT                   GLSRG"
     atgagccctc agaaaacagg cgtcccgccg ggcgagttcg acatcttcct ctccctcggc        60
     ggccccgacc gggtcgaggc gaacctgctc aaggaggcgc tggtcaagga agggctgacc       120
     gtcttcatcg acgaggacga catcaggcac ttcgacggca tcacccggga gatagaacgg       180
     tgcctgcgat cctcccgggc gctactcgcc tactactcca gagagtatcc gctgcgctcc       240
     gcgtgccagt tcgagctgac cgcggctctg ttggcgggac ggaacgagca ggacccgacg       300
     cggcggatca tcgtcgtcaa ccccgaggcg accgaggatc atatccagcc cgcctacatc       360
     agcgacgcgc ggttcgcggt gcgccccggc agcgaccacg agcggaaggc tctggcggcg       420
     ctgatcaagc agaaggtgga cacgctcgaa ggaccgctca gctcgatcgc cttcacccga       480
     cggccgcgct ggttcgcctt ccggatcgcc ggcgcgccgg gcttcgtggg ccggtaccgc       540
     gagttgtggg agctggacag tctactgacc aaggccgcac tgccgctcac ccaggacacg       600
     ccgttcgggc cggtcgcggt ggtcacggga gccgcgcggg tcggcaagag cagcctggtg       660
     gcggactatg cgtggcagtt cggcgcggct ttccgcggcg gtgtctattg gatcgacatg       720
     tccggcgtcg aggggaccgc ggaccaggtg cttgccgcct acgctgaccg agtccgctcg       780
     agcgccgcaa tcgcgggcct cgatgtcgcc gggctcagtc gggagcggat gttcggcgtg       840
     ctcggcgatc atctcgccgc tactgcggag cccagcttgt ggattgtcga cggcctgccc       900
     gcgggactgg gcgaacaggc tccgcaccgt atgatcatcc cggctggcga tcgggtgcag       960
     accgtcttcg tcgggcggcg cgacccgttc ggtggggcga tccgcgcgat ggtgctcggc      1020
     ggcttgagcc ggggatga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page