(data stored in ACNUC7421 zone)

EMBL: CP001700.PE225

CP001700.PE225       Location/Qualifiers
FT   CDS_pept        250633..252387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5075 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69180.1"
FT                   /translation="MLAGGRLQDRQGLRSHAEVLADFDGVADIDRFFGVLVRESIGELD
FT                   TARTLVLAVASVCAAAGIPAGLLVRAVATLANGAIDASAVGDALRGLQAAGLAANDDGR
FT                   WSISAVARELAREQNPPGPRRQYLRTVVADALTPMLQDAATSLGDRPGLVTHAVRLCGE
FT                   ADRSEDARWLAILLERLAEHYEARGEAASSAVYRDRLLDIRGENTSDLFYAARAAQAAR
FT                   EFDKAAGLAQRALSGAGSDEPQFRRCRLLLAEALDGALRFQEAETYWEHVAASAGDRDA
FT                   GESTGRAAESVAYARSRIRRGELRRAKQALKLLIEEYARSSGDVEFTTADAVGGQIRGA
FT                   RIEYAHVLALIGDQIEARRVASELVAIYREAGLLRHADMVRAQEILAEAKLVPHIRELR
FT                   LDDTARARAEQDMKQLWQKNREEDGPRSPSALFAGVGYGHALVSQGRKEKARDMLVGLR
FT                   ADAIAVGGPRDPAYLRATFLLGQAYAQMRCYRKALKMFRYAYANQQEILGPAHPYTLAS
FT                   GFELAVMYKTVGEDTEAAKLIREQDALSAKSMEYSNDLRAQIKVAGSLIALIPSPLWRW
FT                   MRGPERDC"
     gtgctggctg ggggccgact ccaggatcgt caagggctgc gctcgcatgc cgaggttttg        60
     gccgacttcg atggtgtcgc cgacatagac cggttcttcg gcgtactggt ccgggagagc       120
     atcggtgagt tggacacagc ccggacgctt gtgctggcgg tcgcgtcggt ctgcgccgcg       180
     gccggcattc ccgcggggct ccttgtccgg gcggtcgcga cgctcgccaa tggcgcgatc       240
     gacgcgtcgg cagtgggcga cgccttacgg ggtctgcagg cggccggtct ggccgccaac       300
     gacgacggcc ggtggtcgat ctccgcggtc gcccgggaac tggcgcgcga gcagaacccg       360
     ccgggaccac ggcggcagta cctccggacc gtggtcgccg acgcgctcac accgatgctc       420
     caggatgccg ccacttcgct cggcgaccgg cctggcctgg tgacacacgc agttcggctg       480
     tgtggcgagg ccgaccggag cgaggatgcc cgctggcttg cgatcttgct ggaacggctc       540
     gcggagcatt atgaggcgcg cggtgaggcc gcttcgtcgg cggtctaccg ggaccgtctg       600
     ctcgacatcc gcggggagaa cacctcggac ctgttttatg cggcgcgtgc tgctcaggca       660
     gcgcgcgaat tcgacaaggc agctggcctg gcgcagcgcg ctctgtcagg tgccggaagc       720
     gacgagcccc agtttcgccg ttgtcggctg ctgttggccg aggcgttgga cggcgcattg       780
     cggtttcagg aagctgaaac gtactgggag cacgtggcgg cgtcggccgg cgaccgtgac       840
     gccggggagt caacaggacg cgccgcggag tcggtcgcgt atgcgagatc gcggatccga       900
     cggggtgagc tgcgcagggc caagcaggct ttgaagttgc tcatcgagga gtacgcacga       960
     tcgagcggag acgtggagtt cacgacagcc gatgcagttg gtggtcagat ccgaggcgcg      1020
     cgcatcgagt acgcgcacgt gttggcgctg atcggggatc agatcgaggc gcgccgcgtg      1080
     gcgtcggagc tggtggccat ctaccgcgaa gccggtctgc tgcgccacgc cgacatggtg      1140
     cgggcacaag agatcctggc cgaggcgaaa ctggtgccac acatcaggga actgcgacta      1200
     gacgacactg ccagggcacg ggcggagcag gacatgaagc agctctggca gaagaaccga      1260
     gaggaagacg ggccgcgtag cccgtccgcg ctattcgcgg gggtgggcta cggccacgct      1320
     ctggtctcac agggacgcaa ggagaaggca cgcgacatgc tcgtgggttt gcgcgcagac      1380
     gcgatcgcag tcggtgggcc gcgtgatccc gcgtatttgc gggcgacatt cctgctgggg      1440
     caggcatacg cccagatgag gtgctatcga aaggcgttga agatgttccg gtacgcctac      1500
     gcgaaccagc aggagattct cggcccggcg cacccgtaca cattggcgag cgggttcgag      1560
     ctggccgtca tgtacaagac ggtgggtgag gacaccgagg cggccaaatt gatccgcgaa      1620
     caagacgcgc tgagcgccaa gtcgatggag tactcgaacg atctccgcgc ccagatcaag      1680
     gtcgccggat cgctgatcgc gctgattcct tcgccgctgt ggcggtggat gcggggacct      1740
     gagcgggatt gctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page