(data stored in ACNUC7421 zone)

EMBL: CP001700.PE226

CP001700.PE226       Location/Qualifiers
FT   CDS_pept        252889..255201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0228"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sen:SACE_0488 SARP family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69181"
FT                   /db_xref="GOA:C7QJ39"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ39"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69181.1"
FT                   /translation="MRPEWDRYAQRLKALRSEQGLSQRRLARALHVDHSVISRAESAVR
FT                   RPDPDLAASIDLLLSTGGELQRLARDAVRKQASADSLSTRGGPSGAVPRLRSSIPPDSV
FT                   HFTGRNAEFDQVRSELVERPDAVGAASVCVISALAGVGKTALAIHSAHRLAGRFPDGCL
FT                   FLDLRGFTPGHAPLSSFEALGALLALLDVPVATIHSTEPARSAQFQAETAGARLLLVLD
FT                   NAADAHQVRLLLPSAPGCRVLVTSRNRLVALDEAVHLDLRPLAEVDAAALFRMVSAGGR
FT                   VSQSTVDGIVARCAGVPLALRIAAARCAPGGAFDPELLAAELSRAEDFIGQLDDGERSV
FT                   RAVFDASFSLLPRELRQVLALLGTRLLTVFDIWDVAMLADLPLLGAAGALERLHAASLL
FT                   EVRGTDRFVLHDLVAEYAISAAGQTLGAEQLRAAIGRLLDAYLRVCDRADSQVTPHRHR
FT                   FPLAVAAAGAVPDPDFSDYYEALDWQTKHLDTAAALCETAYEHGFDEQCWQLAYALRGV
FT                   FFLTKHWEQWDRIQRIALAATRRLQDPHAECVTLNNLGLILGERGETDAAHRCLNEAES
FT                   VCRAARDRFGENTARAHRAWLFHTAGRHGESLTEHEGVLEFYTQIDSPRNVAIVMRDMA
FT                   ASEAALGHTDSALAHLHAAEQAFRKLDLTMDLAMALNDLGETYTAIIDPKRAAEYFEAA
FT                   LAACAESGSDHERARAHAGLGALAESAGRQNWANAHYLQALRLFDALGAPAADVVRARL
FT                   HASTVMFPTTAEEDENR"
     atgcggcccg aatgggacag gtacgcccaa cgtctcaaag ccttgcggag cgaacagggg        60
     ctgagccagc ggcgtctggc gcgggctcta catgtggacc atagcgtgat ctcgcgtgcg       120
     gagagtgccg tccgtcgtcc cgatcccgac ctcgcggcct cgatcgacct gctgctgagc       180
     acgggtggcg agttgcagcg gttggctcgg gacgcggtgc gaaagcaggc gtcggccgac       240
     tcactatcga cgcgtggggg tccttctggt gcggtcccgc ggttgcgatc gtctataccg       300
     cccgactccg tgcacttcac tggtaggaac gcggagtttg accaggtgcg atcagagctc       360
     gtcgaacggc ccgacgcggt cggcgccgcg agcgtctgcg tgatcagcgc gctggccggt       420
     gtgggcaaga cagcgctcgc catccacagc gcgcaccgcc tcgccggccg ttttccggac       480
     ggatgtctgt tcctcgatct gcgtggcttc actcccggac acgcgccgct gagcagcttc       540
     gaggcgctgg gagctctgct cgccttgctg gatgtcccgg tcgccaccat ccacagcacc       600
     gagccggcgc gctcggcgca gttccaggcg gagaccgccg gcgcgcggct gctgctggtg       660
     ctagacaacg ccgctgacgc acatcaggta cgactgctct tgccatcggc gcctggctgc       720
     cgggtattgg tgacgagccg gaaccgcctt gtggcccttg acgaggccgt gcatctcgac       780
     ctgcggcccc ttgccgaggt tgatgccgcc gcgctgttcc gcatggtgtc ggccggcggt       840
     cgtgtctcgc agagcactgt cgacggtatc gtcgcgcgct gtgccggcgt cccattggcg       900
     ttgcggatcg cggcggcacg ctgcgctccc ggcggcgcgt tcgatccgga actgctcgcc       960
     gccgagctgt cgcgcgcgga ggacttcatc gggcagctgg acgacgggga acgcagcgtg      1020
     cgtgcggtgt tcgatgcctc gttctccttg ctgccccgag agctgcggca ggtgcttgct      1080
     ctgctcggca cccgtctgct gaccgtcttc gacatttggg acgtcgcaat gctcgccgac      1140
     ctcccgctcc tcggcgcggc tggcgcgttg gaacggctgc acgcggcgag tctgcttgaa      1200
     gtgcgcggca ctgatcgttt cgtcctgcac gatctggtcg ccgagtacgc gatatccgcc      1260
     gccggacaga cgctcggcgc cgagcagctg cgggccgcaa tcggacgctt gctcgacgcc      1320
     tatctgcgcg tctgtgacag ggccgactca caggtcacgc cgcatcggca ccgcttcccg      1380
     ctcgcggtgg cggcagccgg agctgtgcca gacccggact tcagtgacta ctacgaggcc      1440
     ctcgactggc agaccaagca tctcgacacg gccgcggcgc tgtgcgaaac cgcctacgag      1500
     cacggtttcg acgaacagtg ctggcaactc gcctacgcgc tgcgcggggt cttcttcctc      1560
     accaagcact gggagcagtg ggatcgtatc cagcgcatcg cgctggcggc gacaagacgg      1620
     ctccaagacc cgcacgccga gtgcgtgact ctgaacaacc tcggcctcat cctcggtgaa      1680
     cggggcgaga ccgacgccgc gcaccgctgc ctcaacgagg ccgaaagcgt gtgccgcgcc      1740
     gcccgtgatc gcttcggcga gaacaccgca cgcgcccaca gggcctggct cttccacacg      1800
     gccggacggc atggcgagtc cctgaccgag cacgagggcg tcctcgagtt ctacacgcag      1860
     atcgacagcc ctcgcaatgt ggccatcgtg atgcgcgaca tggccgcatc cgaagccgct      1920
     ctaggccaca ccgacagtgc cctcgcgcac ttgcacgcgg ccgagcaggc ctttcgcaaa      1980
     ttggatctga cgatggacct ggccatggcc ctgaacgacc tcggcgagac ctacacagcg      2040
     atcatcgacc cgaaacgcgc cgccgagtac ttcgaagcag cgctggcagc ctgcgcggag      2100
     tccggcagcg atcatgaacg ggctcgagcg cacgccggcc tcggcgccct ggcggagtcc      2160
     gcaggccggc agaactgggc gaacgcacac taccttcagg ccctgaggct gttcgatgcg      2220
     ctcggcgctc cggcggcgga cgtggtgcgc gctcggctgc acgcgtcgac tgtcatgttc      2280
     ccgaccaccg ctgaggagga cgagaaccgc tga                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page