(data stored in ACNUC7421 zone)

EMBL: CP001700.PE227

CP001700.PE227       Location/Qualifiers
FT   CDS_pept        complement(255268..258165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0229"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: fre:Franean1_4251
FT                   tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69182"
FT                   /db_xref="GOA:C7QJ40"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ40"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACU69182.1"
FT                   /translation="MTAPVRDGGENEAVYDVFFSYSWKNLAEALILVAALEARRLQVFR
FT                   DETGMRDFDDIGTEVFAALAGSRSFVALYTPQFPESAYCRLELAHAMTAAYRLDGDVRR
FT                   ILPVVRELPYEAVRPRALQDKRLPARSTGPDALAAVVAERLEEIDDRPFGIASEPGPPN
FT                   WYPFPTVAEPAFHGRATELWDLHDALAGRDDAAQPGQRLARIVGMGGQGKTMLAEQYAR
FT                   WFAADHPGGVFVLRGFGSHRNANSSPALLRTALEQQLARIAEELPGVPAEVEGRSADRS
FT                   ARSVIRDHLERADQDYLWIVDDLPDHVGPIGVREFLAPTARGRTLVTSRHAHRGFVGET
FT                   VELGPLGESAAVRILLGGAGARADRATIASARRLAADLGHHAMAVALVARTLDNNGTAE
FT                   LDQVRTELADPDRDALEWAAAREHEIATDHQGSVAAAMMRSLARLSSAAYEVLLLASIL
FT                   AAAPVPAAMFDSVLGDSRRLDSTRPGMTVDDALRECAALALATVTVGTFGTLWSVHSLV
FT                   SRAVRFRDRFGSGDREQLRARSVEALGEILERGRDGIVDYLPHVRAVAGGATDVAQQSL
FT                   LNEAGRVQVGLGDERAALAMFERLYQACRESLGEDDFATQAGLVGLGVAYGLLGQHELA
FT                   LDFKTRAYEVLARVEGADEEATLTALNNVAVTFGELGDYAKARVLHRQIYATHLKRRGP
FT                   SHPATLASLNAYATARELDGHESLALRLRTRVVAASRRYLRPDDPQLADAISSLAVSHY
FT                   RAGNSAAARALFQEAYDVRRAIYGPSHPDALSALEFAAVCADPEARTAELRAVYRKRVT
FT                   HADPGSPAARRTLRNLIINLRSVHVSTANPPSDSVNRVFSEPVQEPPGDWTEVAVRLDD
FT                   ETTDERVEDFELASYLHGALVAEFGTDHPETLFAETCLGHATVCLGQLDSQIDDGLNVL
FT                   RDAAEGMRVVLGCPEADLAVVDRLIDWAERLAFDD"
     atgacagcgc cggtgcggga cggcggcgag aacgaagccg tatacgacgt cttcttcagt        60
     tactcgtgga agaacttggc cgaggcgttg atactcgtcg cagccttgga ggcgcgacgt       120
     ttgcaggtct tccgcgacga gaccggcatg cgggacttcg acgacatcgg cacggaagtg       180
     ttcgccgcgc tcgctggatc tcgcagtttt gtggcgctct atacgcccca gttcccggag       240
     agcgcatact gccggctgga actcgctcac gcgatgaccg cggcgtatcg cctcgacggc       300
     gacgtgcgcc gaatcctccc cgttgtcagg gagctgccct acgaagccgt tcggccgcgg       360
     gcgctgcagg acaagcgact tcccgcgcgt tccaccggcc cggatgcact cgccgcggtg       420
     gtcgcagagc gattggagga gatcgacgac aggccgttcg ggatcgcctc tgagcctggg       480
     ccgccgaatt ggtatccgtt tccgaccgtc gcggaacctg cctttcacgg ccgtgcgaca       540
     gagctgtggg atctgcacga cgcgttggcc ggacgggatg acgcggcaca gccggggcag       600
     cggctggcgc gcatcgtggg catgggtggc cagggcaaga cgatgcttgc cgagcagtac       660
     gcgcgatggt tcgcagcgga ccatcctggt ggggtcttcg ttctgcgggg attcggtagt       720
     caccgaaatg cgaacagctc acctgccttg ctcaggacag cgctcgaaca gcagctggca       780
     cggatcgccg aggagttgcc gggggtgccg gccgaggtcg aaggacgttc ggctgatcgc       840
     tcggcgcggt cggtgattcg ggaccacctg gagagggccg accaggacta cctttggatc       900
     gtcgacgatc tgccggatca tgtcgggccg atcggtgttc gcgagttcct cgctccgacg       960
     gctcgcgggc gcacgcttgt cacatcacgc cacgcgcatc gtggattcgt cggcgagaca      1020
     gtcgagctgg ggccactcgg cgagtctgcg gcggtgagga ttttgctggg aggcgccggc      1080
     gcgagggctg atcgggcgac gatcgcttcg gcgcgtcggc ttgcggccga tctcggtcac      1140
     cacgccatgg cggtcgcgct ggtcgcccga acactggaca ataacgggac agctgagctc      1200
     gaccaggttc gcacagaact ggccgacccc gatcgcgacg cactcgagtg ggcggcggcg      1260
     cgggagcacg agatcgccac ggaccatcaa ggcagtgtgg cggcggcgat gatgcggtcg      1320
     ctggcgaggc tttcgtcggc ggcatatgag gtattgctgc tggcaagcat tcttgcggcc      1380
     gcacccgttc ctgcggcgat gttcgacagc gtactcggcg acagtcggcg gctcgacagc      1440
     acacgtccgg ggatgacggt tgacgacgcg cttcgagagt gcgccgcact ggcgttggcc      1500
     acggtgacgg taggcacgtt cgggaccttg tggagcgtgc attcactggt gagccgtgcg      1560
     gtgcggttcc gcgaccggtt cggcagcggc gaccgtgagc agctgcgggc caggtccgtc      1620
     gaggcgctcg gggagattct cgagcgcggg cgggacggca tcgtggacta tttgccgcac      1680
     gtgcgtgccg tcgccggtgg cgcgaccgac gtggcccagc agagcctgct gaacgaggcg      1740
     ggacgcgtcc aggtcggcct cggcgacgag cgggccgcgc tggcgatgtt cgagcggctc      1800
     tatcaggcgt gccgggagtc actcggcgag gacgatttcg ccacgcaggc agggctggtg      1860
     ggtctcggcg tcgcctacgg cctgctaggt cagcacgagc tcgcactgga cttcaagacg      1920
     cgtgcctatg aggtgctcgc gcgcgtcgag ggcgcggatg aggaagcgac gctgaccgcc      1980
     ctgaacaacg tggctgtcac attcggcgag ctcggcgact atgcgaaggc ccgagtactc      2040
     caccggcaga tctatgccac ccatctcaag cgccgcgggc cttcgcaccc cgcgacgctc      2100
     gcttcgttga acgcgtacgc gacggctcgc gagcttgatg gacacgagag tctggcgttg      2160
     cgtctcagga cgagggtcgt tgcggcgagt cggcggtatc tgaggcctga tgacccgcag      2220
     ctcgccgacg cgatcagctc gctcgccgtc agccattatc gagcggggaa ttcggccgcc      2280
     gcgcgcgcat tgttccagga ggcctacgac gtgcgcagag ccatctacgg accttctcac      2340
     cccgacgctc tcagcgctct cgagttcgcc gccgtttgcg cggaccctga ggcccggact      2400
     gctgaactcc gcgccgtgta tcgcaagcgt gtcacccacg ccgatcccgg ctctcctgcc      2460
     gcccgtcgca ccctgcggaa cctgatcatc aacctgcgga gcgtccacgt atccaccgcc      2520
     aaccctccat cagactccgt gaaccgtgtc ttctcggagc cggttcaaga acctcctggt      2580
     gattggacgg aggtcgcggt ccgactcgac gacgaaacga ccgacgagcg tgtcgaggac      2640
     ttcgaactcg cttcgtacct gcacggagca ctggtcgcgg agttcggcac agaccacccc      2700
     gagactctct tcgccgagac gtgtctcggc cacgcgaccg tctgcctggg ccagctggac      2760
     agtcagatcg atgacggtct gaacgtgctg cgcgacgccg ccgaaggcat gcgggtcgtg      2820
     ctcggttgcc ccgaagcgga cctggccgtg gtggaccgac tcatcgactg ggcagaacgg      2880
     ctggcgttcg acgactga                                                    2898
//

If you have problems or comments...

PBIL Back to PBIL home page