(data stored in ACNUC7421 zone)

EMBL: CP001700.PE228

CP001700.PE228       Location/Qualifiers
FT   CDS_pept        complement(258162..259667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0230"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69183"
FT                   /db_xref="GOA:C7QJ41"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ41"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69183.1"
FT                   /translation="MAGLDPQERPAGSVPRADQIERMMRRITDGHLRSTGRELTQAAVA
FT                   RYFGVSAETVRSWFSGRRNPGPDRVRDLARFAGVSPIEAFVDAGWLDESDVDPGRSGAG
FT                   GGGDQMYAPEAAVHALLHDETMRARYAVRLLALESHGSYPLTTDVAAQFLLIPGAAVPA
FT                   LADVERLAGMARIVPSPSAAMLRRHPDYCAVRLELAAFVAEPLRWFGQYSWQGDAGSQT
FT                   WRPAADRWPAQILVQDIVSGRSTEAAADGWSCRDQRPLVLIGGRYSSSMAAAMLAGALG
FT                   WQFVLVHSGTVIDRSGQVVATRRDWLSGPAEAWREVAEHVGRSHAAGRPWPAVLAARPH
FT                   SFLTPDGSPDHGALEQLRRTPARIVYARPHEAVLDWWTERQIGLSCEREYKSTALALRK
FT                   QIEAGFDHIEEALRARAETISAERGREDLTIRCRRPSGALDPLRPQIPDGLVDDQVRLA
FT                   WRSLTWLGHTSRHAAELPTRTPRSGPLRRFKRLLEADQEASLS"
     atggccggcc tcgacccgca ggagcgcccc gcgggctccg taccgcgcgc ggaccagatc        60
     gagcggatga tgcggcggat caccgacggc catctacggt cgaccggcag ggagctgacc       120
     caagccgccg tcgcgcggta cttcggggtc agcgcggaga cggtacgttc atggttcagc       180
     ggacggcgca atccgggtcc ggatcgggtg cgggacttgg cccggtttgc gggagtcagt       240
     ccgattgagg cgttcgtcga cgcgggctgg ctcgacgagt ccgacgtcga tccaggtcga       300
     agtggcgccg gtggcggcgg tgaccagatg tacgcgcccg aagccgcggt ccacgcgctg       360
     cttcatgacg agaccatgcg ggcgcggtat gccgttcggt tgctggcact ggagtcacac       420
     ggaagctatc cactcaccac cgacgtcgcg gcgcagttcc tgttgatacc gggcgccgct       480
     gtaccagcgt tggctgacgt ggagcggctg gccgggatgg ctcgcatcgt gccgtcgccg       540
     agcgccgcga tgctgcggcg ccacccggat tactgtgcgg tgcgtttgga actggccgcg       600
     ttcgtagccg agccgctgcg ctggttcggg cagtacagct ggcagggtga cgccggttcg       660
     cagacatggc gtcctgccgc cgaccggtgg cccgcgcaga tcctcgtgca ggacatcgtg       720
     agcggccggt ccaccgaagc cgcggccgat ggctggagct gccgggatca gcgtccgctg       780
     gtcctgatcg gcggccggta cagctcgagt atggctgccg cgatgcttgc cggggcgctc       840
     ggatggcagt tcgtgctcgt gcactccggc acggtcatcg accggagcgg gcaggtggtc       900
     gccacgaggc gggactggct cagcggtccg gccgaggcgt ggcgggaggt ggcggagcac       960
     gtgggccggt cgcatgcggc gggcaggccc tggcccgcgg tgctcgcggc acgtccccat      1020
     tcgtttctca cgccggacgg ctcgccggac cacggtgcgt tggagcagct acgccgcacg      1080
     ccggccagga tcgtctacgc gcggccgcat gaggctgttc tggactggtg gacggaacgg      1140
     caaatcggct tgtcgtgcga acgcgagtac aagtcgaccg cgttggcgtt gcggaagcaa      1200
     atcgaagcag ggttcgacca cattgaggag gccctgcgtg cccgggcgga gactatctcg      1260
     gccgaacggg gccgagagga tctcacgatc cggtgccgtc gtcccagtgg tgccttggat      1320
     ccgctgcgtc ctcagattcc cgacgggctt gtcgatgacc aggtgcggct ggcttggcgg      1380
     tcgttgacgt ggctcgggca cacgtctcgg catgcggcag agctccccac ccggacgcct      1440
     cgctctggcc cgctacggcg tttcaagcgg ctgctggagg ccgatcagga ggcgtcgctc      1500
     tcatga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page