(data stored in ACNUC7421 zone)

EMBL: CP001700.PE229

CP001700.PE229       Location/Qualifiers
FT   CDS_pept        259902..260978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0231"
FT                   /product="clavaminate synthase"
FT                   /note="KEGG: kra:Krad_3958 clavaminate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69184"
FT                   /db_xref="GOA:C7QJ42"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR014503"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="PDB:6F2A"
FT                   /db_xref="PDB:6F2B"
FT                   /db_xref="PDB:6F2E"
FT                   /db_xref="PDB:6F6J"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7QJ42"
FT                   /inference="similar to AA sequence:KEGG:Krad_3958"
FT                   /protein_id="ACU69184.1"
FT                   /translation="MKNLSAYEVYESPKTSGESRTEAVSEAAFESDPEVSAILVLTSSE
FT                   ASTLERVADLVTAHALYAAHDFCAQAQLAAAELPSRVVARLQEFAWGDMNEGHLLIKGL
FT                   PQVRSLPPTPTSNVHAVAATTPMSRYQALINECVGRMIAYEAEGHGHTFQDMVPSAMSA
FT                   HSQTSLGSAVELELHTEQAFSPLRPDFVSLACLRGDPRALTYLFSARQLVATLTTQEIA
FT                   MLREPMWTTTVDESFLAEGRTFLLGFERGPIPILSGADDDPFIVFDQDLMRGISAPAQE
FT                   LQQTVIRAYYAERVSHCLAPGEMLLIDNRRAVHGRSIFAPRFDGADRFLSRSFIVADGS
FT                   RSRHARSSFGRVVSARFS"
     atgaagaacc tgtctgcgta tgaagtgtat gaatcgccga agaccagcgg agagtcacgt        60
     accgaagccg tttcggaggc cgccttcgaa tccgaccccg aagtgagcgc aatcctagtc       120
     ctgacctcct ccgaagcctc gacgctggag cgcgtcgccg acctcgtgac cgcgcacgcg       180
     ctgtatgccg ctcacgattt ctgtgcccag gcccagctgg ccgccgccga actgccgtcg       240
     cgggtcgttg cccggttgca ggagttcgcc tggggcgaca tgaacgaggg ccaccttctg       300
     ataaaaggcc tgccgcaggt ccgctccctg ccaccgacac cgacgtccaa cgtgcacgcc       360
     gtcgccgcga cgacgccgat gtcgcgctac caggccctca tcaatgagtg cgtggggcgc       420
     atgattgcct acgaggccga ggggcacggc cacaccttcc aggacatggt cccgagcgcc       480
     atgagcgcgc actcgcagac cagtctcggc tcggcggttg agctcgaact gcacaccgag       540
     caggccttca gtccgctgcg tccggacttc gtcagcctgg cctgtcttcg cggcgatcca       600
     cgagccctga cttacctgtt ctcggcccgg caactggtcg cgacgctgac gacacaggaa       660
     atcgccatgc tgcgcgagcc catgtggacc accaccgtcg acgagtcctt cctggcggag       720
     gggcgtacgt tcctgctcgg cttcgagcgc ggtccgatcc cgatattgag cggtgccgac       780
     gacgatccgt tcatcgtctt cgaccaggat ctgatgcggg ggatctcggc gcccgcgcag       840
     gaactccaac agactgtgat ccgcgcctac tatgccgagc gcgtcagcca ctgcctcgca       900
     cccggtgaga tgctcctcat cgacaaccgg cgcgccgtcc acggcaggtc gatcttcgcc       960
     ccgcgtttcg acggcgctga ccggttcctt tccagaagct tcatcgtggc cgacggatcg      1020
     cgcagtcggc acgcgcgttc ttccttcggc cgcgtcgtct ctgcgaggtt cagctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page