(data stored in ACNUC7421 zone)

EMBL: CP001700.PE23

CP001700.PE23        Location/Qualifiers
FT   CDS_pept        complement(24190..24807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0023"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_2766
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68978"
FT                   /db_xref="GOA:C7QFN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU68978.1"
FT                   /translation="MSNRDDLLAGAKKCLLEKGYSRTTARDIAQASGVSLAAIGYHFGS
FT                   KDALMNEAMFQAIGEWGDHLEEAFAKAGPNLSVQERFARVFDDVSATFDENQALWMASF
FT                   ELIIEIDRIPGARDMFRKAIPEARTGLANLILGIPEEDVDKDMEMGAGAVLYSLMAGLL
FT                   IQRFADTGQTPTGADLARGLRQLADVLEADVLKSSDKAAAVS"
     atgagcaacc gtgacgacct cctcgcgggg gccaagaagt gcctgctgga gaagggctac        60
     tcgcgcacca cggcgcgcga catcgcccag gcctcgggcg tcagcctggc cgcgatcggc       120
     taccacttcg gctccaagga cgcgctgatg aacgaggcga tgttccaggc catcggggag       180
     tggggcgacc acttggagga ggccttcgcc aaggccggcc cgaatctgtc ggtccaggag       240
     cgcttcgccc gggtcttcga cgacgtctcc gcgaccttcg acgagaacca ggcgctgtgg       300
     atggccagct tcgagctgat catcgagatc gaccgcatcc ccggcgcgcg cgacatgttc       360
     cggaaggcga tcccggaggc gcgcacgggc cttgccaacc tgatcctcgg catccccgag       420
     gaagatgtgg acaaggacat ggagatggga gccggcgctg tcctgtactc cctgatggcc       480
     ggtctgctca tccaacgctt cgccgacacc gggcagacgc cgaccggagc cgatctggcc       540
     cgaggactgc gtcagctcgc tgatgtccta gaggctgatg tccttaagag cagcgacaaa       600
     gcggccgcag tctcttaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page