(data stored in ACNUC7421 zone)

EMBL: CP001700.PE230

CP001700.PE230       Location/Qualifiers
FT   CDS_pept        260978..261880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0232"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="KEGG: cmi:CMM_0528 putative metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69185"
FT                   /db_xref="GOA:C7QJ43"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ43"
FT                   /inference="similar to AA sequence:KEGG:CMM_0528"
FT                   /protein_id="ACU69185.1"
FT                   /translation="MSDSFCSTVVTFPEGAIEASSTIVHIQRVLGLDPKATHWAVFTEA
FT                   TPFHPVDPTWPDQPGDTGVLLTDVGELPVTGCVTAAVARAGGELLVDAEITAKRGDPEY
FT                   AWLVCHLVADRAGDLPGRLVGTAAKLLVDRRRRRRLSVAHTACHLTGLALNVNLADRWR
FT                   KPIRTDGLGRPDFDGVAIVSSRIAEDGAMDTYRLGTSLRKAGFVSEGFADGVSALQSAI
FT                   ETSVAEWVRQAGQITVLTKGSALHDRRTWECVLQEGTARTSCGGTHPQNTGELGSVTVR
FT                   CAFDPDTKLLTVATTVVPS"
     atgagcgact cgttctgctc tactgtcgtc acatttcctg agggcgcgat cgaagcctcg        60
     tcgacgatcg ttcacatcca gcgtgtcctc ggtctggacc cgaaggcgac gcactgggcc       120
     gtcttcacgg aggcgacacc gtttcatccg gtcgacccca catggccgga ccaaccgggg       180
     gacaccgggg tgttgctgac cgacgtcggc gagctgccgg tcaccggatg cgtgaccgct       240
     gcggtcgccc gggcgggagg cgagcttctc gtggacgcgg agatcactgc gaagcgcggc       300
     gatcctgagt acgcctggct cgtctgccat ctcgtggccg acagggctgg ggacctgccc       360
     ggccggctcg tcggcacggc ggcgaaactg ctggttgatc ggaggcggcg gcgtcggctc       420
     agcgtcgcgc acactgcgtg ccacctgaca ggtctcgcgc tgaatgtgaa ccttgccgat       480
     cggtggcgca agccgatcag aaccgacggt ctcggacgtc ccgacttcga cggcgtggcg       540
     atcgtgtcgt cccggatcgc cgaggacggc gccatggaca cctaccggtt gggcacgtcg       600
     ttgcggaagg cgggcttcgt cagcgagggg ttcgcggacg gtgtgtcggc gctgcaatcg       660
     gctatcgaaa catccgtagc ggagtgggta agacaggctg gacagatcac cgttctgaca       720
     aaagggtcgg cactgcacga ccgtcgcacg tgggaatgcg tccttcagga gggaaccgcg       780
     cgcacgtcct gcggaggaac ccatccgcag aacaccggcg aactgggctc tgtgactgtg       840
     cggtgcgcct tcgacccgga taccaagctt ctcaccgtcg ctacgacggt tgtgccgtcg       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page