(data stored in ACNUC7421 zone)

EMBL: CP001700.PE232

CP001700.PE232       Location/Qualifiers
FT   CDS_pept        complement(263541..264188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0234"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: sco:SCO5845 thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69187"
FT                   /db_xref="GOA:C7QJ45"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ45"
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /protein_id="ACU69187.1"
FT                   /translation="MAELVFFTGTMDSGKSTLALQLDHNHNARGRAGLIFTRDDRAGSA
FT                   TISSRLGLKAAAVEVGQNTDLLNHVVQLMSAGGKVDYVVADEAQFYTEDHIEQLARMVD
FT                   ELSIDVYAFGITTDFRTRLFPGSKRLIELADRIEVLQVQTLCWCGARATHNARTLGGEM
FT                   VVEGEQVVVGDTAVADEIGYEVLCRRHHRRRLTAARSGAAALSPDTLPFGAA"
     atggccgagc tcgtcttctt caccggaacc atggacagcg gcaagtcgac cctcgccttg        60
     caactcgacc acaaccacaa cgcccgcggc cgggccgggc tcatcttcac ccgcgacgac       120
     cgcgccggca gcgccacgat ctccagccgg ctgggcctga aggccgccgc cgtggaggtc       180
     ggccagaaca ccgatctgct caaccacgtc gtgcagttga tgtccgccgg cggcaaggtg       240
     gactacgtgg tcgccgacga ggcgcagttc tacaccgagg accacatcga acagctggcg       300
     cgcatggtcg acgagctgag catcgacgtc tacgccttcg gcatcaccac cgacttccgc       360
     acccggctgt tcccaggcag caagcgcctg atcgaactcg ccgaccgcat cgaggtcctg       420
     caggtccaga cactgtgctg gtgcggcgcc cgcgccacgc acaacgcccg caccctcggc       480
     ggcgagatgg tcgtggaagg cgagcaggtc gtggtcggcg acaccgccgt cgccgacgag       540
     atcggctacg aggtcctgtg ccgccgccac caccgccgcc gcctgaccgc cgcccgctcc       600
     ggcgcagccg cactgagccc ggacacgctt ccgttcggcg cagcctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page