(data stored in ACNUC7421 zone)

EMBL: CP001700.PE233

CP001700.PE233       Location/Qualifiers
FT   CDS_pept        complement(264205..264516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69188"
FT                   /db_xref="GOA:C7QJ46"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69188.1"
FT                   /translation="MIRRSLTALAAAAAAELCCVAGSYLHAIRLVAHVEGVSVWTALNS
FT                   RHNASLTAWRASLTVGDRLLFVAVALVAAAAVLARPYLKPTFGRIRTRITSVRGLPRA"
     atgatccgac gctcgctcac cgcactggcc gccgccgcgg ccgcggagct gtgctgtgtc        60
     gcgggcagct acctgcacgc gatacgcctg gtcgcgcacg tcgagggcgt ctcggtctgg       120
     accgcgctga actcgcggca caacgcctcg ctgaccgcct ggcgcgcctc actgaccgtc       180
     ggcgaccggc tgctgttcgt cgccgtggcg ctcgtggcgg cggccgcggt gctcgcgcgg       240
     ccgtatctga agccgacatt cgggcgtatc cgtacgcgaa tcacgagcgt tcgcgggctg       300
     ccgcgcgcat ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page