(data stored in ACNUC7421 zone)

EMBL: CP001700.PE234

CP001700.PE234       Location/Qualifiers
FT   CDS_pept        complement(264689..265114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0236"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   mmi:MMAR_5292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69189"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ47"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ACU69189.1"
FT                   /translation="MSQQPYGQPGYQQGPPPQQGQYAPPPQQQGFQQNFLCVTTNDIPG
FT                   YRIDAVYGEVFGLTVRSRNAFSQMGAGLKSMFGGELKGMTKALMDSRNDVMQRMIQEAI
FT                   NRGGNAIVGMRFDTSEMGDVWTEICAYGTAVTISRQG"
     atgagccagc agccttacgg acagcccggt taccagcagg gcccgccgcc gcagcagggg        60
     cagtacgctc cgccgccgca gcagcagggg ttccagcaga acttcctgtg cgtcaccacg       120
     aacgacatcc cgggctaccg catcgacgcc gtctacggcg aggtcttcgg cctcaccgtg       180
     cgcagccgca acgccttcag ccagatgggc gccggcctga agtcgatgtt cggcggcgag       240
     ctcaagggca tgaccaaggc gctgatggac agccgcaacg acgtcatgca gcggatgatc       300
     caggaggcca tcaaccgggg cggcaacgcc atcgtcggca tgcgtttcga cacctcggag       360
     atgggcgacg tctggaccga gatctgtgcc tacggcaccg cggtgacgat cagccgccag       420
     ggctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page