(data stored in ACNUC7421 zone)

EMBL: CP001700.PE235

CP001700.PE235       Location/Qualifiers
FT   CDS_pept        265300..266295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0237"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sma:SAV_4224 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69190"
FT                   /db_xref="GOA:C7QJ48"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ48"
FT                   /inference="protein motif:PRIAM:3.1.4.46"
FT                   /protein_id="ACU69190.1"
FT                   /translation="MHSLRPSEPRPSERRRSEPVSPVRQHAALRTGASGPGLPRRPALE
FT                   IPVIAHRGASDDVPEHTLAAYEAALLQGADGLECDVRLTADMQLVCVHDRRVNRTSNGR
FT                   GVVSTLELAQLRQLDFGSWKQPAAGEEHEYAEYPDLRREGAHRVLTLERLLQLVVEHPH
FT                   RVEMAIETKHPTRYAGLVEEHLVALLDRFGLAHPRLGETSPVRVMSFSAMSVRRIRRLA
FT                   PSLDTVLLLDRVPLRLRDGSLPRGVRIAGPGIHILRIHPEYVERVHSMGNRVHVWTVDQ
FT                   PSDIDLCVELGVDAIISNRPKAVLARLGRDGTAAAAAARHGVVELNPDSP"
     gtgcactcct tgcgcccctc cgagccccgt ccgtccgaac ggcgccgctc cgagccggtc        60
     tcgccagtcc ggcagcacgc cgcgctgcgt accggcgcct ccggccccgg gctcccccgc       120
     cggcccgccc tggagatccc cgtcatcgcc caccgcggcg cgtccgatga cgtgccggaa       180
     cacacgctgg ccgcgtacga agccgcgcta ttgcaaggtg cggacggctt ggagtgcgac       240
     gtacgactca cggcggacat gcagctggtg tgcgtgcatg atcgccgggt gaaccgcacc       300
     tccaacggcc ggggtgtggt ctccacgttg gagctggcgc agttgcggca gttggacttc       360
     ggctcctgga agcagccggc ggccggcgag gagcacgagt acgccgagta cccggacctg       420
     cggcgtgagg gcgcgcaccg ggtgctgacc ctggaacggc tgctgcagct ggtggtggag       480
     catccgcacc gggtggagat ggcgatcgag accaagcacc cgacccggta cgccggcctg       540
     gtcgaggagc acctcgtggc gttgctggac cggttcgggc tggcgcatcc gcggctgggg       600
     gagacctcgc cggtgcgggt catgtcgttc tcggcgatgt cggtgcggcg gatccgtcgg       660
     ctcgcgccgt cgttggacac ggtgctgttg ttggaccgcg ttccgctgcg attgcgggac       720
     ggctcactgc cgcgcggggt gcgtatcgcc ggaccgggaa tccatattct gcgaatccat       780
     ccggaatacg tggagcgtgt gcattccatg ggaaatcgcg tgcacgtctg gacagtggat       840
     cagccctcgg acatcgacct gtgtgtcgaa ttgggcgtgg acgcgatcat ctccaaccgc       900
     cccaaagccg tgctggccag gctgggccgc gacggcacgg cggccgcggc cgcggcgcgt       960
     cacggcgtcg tcgagctgaa ccccgattca ccctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page