(data stored in ACNUC7421 zone)

EMBL: CP001700.PE236

CP001700.PE236       Location/Qualifiers
FT   CDS_pept        266366..267253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0238"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sco:SCO3975 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69191"
FT                   /db_xref="GOA:C7QJ49"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ49"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69191.1"
FT                   /translation="MGVVMSVQPESPRKSVSLSTTVTRAPAPRPADSRGTGGTEFPYTP
FT                   ESVGTARHALADALQRMRVAPPAADDAVLILSELVSNALRHALPLAGGTIRVAWWMADD
FT                   KVLRIAVTDGGRQQPGQAPPLKAAEAPDLVAPDLDDIDESAVDGRGLGIVGLLADAWGV
FT                   EPWYAPETEATSPYLHAATTSATASAASSAATSRAIHPDPSAPKTVWAAVRLHARHAAP
FT                   PPPDDQDRRWWRRMRLSLTAHLPGTTRPRTRGTRLGGSRLGEARGGPDSDAAGSDTAWV
FT                   PRYPEARVGCAAAG"
     gtgggggtcg tcatgtcggt gcaaccggag agtccccgga aatcagtgag tttgtccacg        60
     acggtcacac gcgccccggc gccacggccc gcggacagca gaggcacggg cgggaccgag       120
     ttcccgtaca cacccgaaag cgtcggcacg gcccgccacg cgctggccga cgcactccag       180
     cgcatgcgcg tggcaccccc agccgcggac gacgcggtcc tgatcctctc ggaactggtg       240
     agcaacgccc tccggcacgc cctaccgctg gccggcggca ccatccgagt cgcctggtgg       300
     atggccgacg acaaggtcct gcgcatagcc gtgaccgacg gcggccgcca acaaccgggc       360
     caagcaccac cactcaaagc cgcagaagcc cccgacctgg tggcacccga cctcgacgac       420
     atcgacgaat ccgccgtgga cggccgcgga ctcggcatcg tgggcctcct ggccgacgcc       480
     tggggcgtcg aaccctggta cgcccccgaa acagaagcaa cgagccccta tctacacgcc       540
     gccaccacat cagcgacggc atcagcggca tcatcggcgg cgacatcccg cgctattcac       600
     ccggacccca gcgcccccaa aacagtctgg gcagcagtcc gcctccacgc ccgccacgca       660
     gcgcccccac cccccgacga ccaagaccgc cgctggtggc gccgcatgcg cctgtccctc       720
     acagcccacc tccccggcac cacccgcccc cgcacccgcg gcacccgcct gggcggctcc       780
     cgcctcggcg aagcccgcgg cggcccagac agcgacgcgg cgggttcgga taccgcctgg       840
     gtgccgcgat atcccgaggc gcgcgtggga tgcgcggctg ccggttga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page