(data stored in ACNUC7421 zone)

EMBL: CP001700.PE237

CP001700.PE237       Location/Qualifiers
FT   CDS_pept        complement(267790..269736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0239"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; Chorismate
FT                   binding-like; KEGG: stp:Strop_2960 glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69192"
FT                   /db_xref="GOA:C7QJ50"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ50"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ACU69192.1"
FT                   /translation="MPHQGQGQDTLTSPSPSLPDGPFALIRRGVEAEVELLTGQAFEQF
FT                   PALADLPTEDSDALLALVPYRQLTERGDECHDDHAPLLAMRITERRRFGIAQLPPATPP
FT                   VLRDGAFDVDDEAYGASVKRVLDEEIGAGEGSNFVLRRTFVGHCDSARETAYGAFCALL
FT                   EKERNAYWTFLIDTGEGFMVGATPERHVSLADGVAVMNPISGTLREAPATASRERVLAF
FT                   LQDAKEREELAMVVDEELKMLAEVGDLGGRVRGPFLKEMANLAHTEYYIEARTTMDPRL
FT                   ILRTTMFAPTATGSPIRNAFRVIKRHERGGRGYYAGVAALIGRDEAGAPTMDAPLLLRV
FT                   AYVENDGTVRVPVGATLVRGSDPYEEVRETYAKAAGVLRAFGVGFGARGGLAVGTEVAP
FT                   LGGSDAAAASVTPAPLSAPDATPIRTTPWSEDPEIAALLSARNESLSGFWLNEHEPADL
FT                   VDPQLAGRKVLIVDNEDAFTSMLAVELRALGLETTRVSHDEVPDHTTYDLVLLGPGPGD
FT                   PRDTASPRMTSVRTLAKLLIDHRVPTLGLCLGHEALAAALGLELVRLPTPMQGTQVELD
FT                   LFGTTERVAFYNSYAARKPEFLVLDTVLLPGTTLTAALRGPSFTGLQFHPESVVTMDGL
FT                   GILSREIRRLLTR"
     atgccacacc aaggccaagg ccaggacacc ctgacgtcgc cgtcgccgtc gcttccggac        60
     gggcccttcg cgctgatccg gcgcggcgtc gaggcggagg tcgaactgct caccggacag       120
     gccttcgagc agttccccgc actggcggat ctccctactg aggactctga tgcgctccta       180
     gcactcgtcc cctataggca actcacggag cgcggggacg agtgtcatga cgaccatgct       240
     ccgctgctcg ctatgcggat cacggagcga cgcaggttcg ggatcgcgca gttgccgccg       300
     gctactccac cggtgttgcg ggacggcgct ttcgacgtgg atgacgaggc gtatggcgct       360
     tcggtgaagc gggtgctgga tgaggagatc ggtgcgggcg aggggtcgaa cttcgtcttg       420
     cggcggacct tcgtcggaca ctgcgattcc gcaagggaga cggcgtacgg agcgttctgc       480
     gcattgctgg agaaggagag gaacgcttat tggacgttcc ttatcgacac cggcgagggg       540
     ttcatggtcg gggcgacacc cgagcggcac gtgtcgctcg ccgacggtgt cgcggtgatg       600
     aacccgatca gcgggacgct gcgcgaggcg ccggcgacgg cttcgcggga gcgcgtactg       660
     gcgttcctgc aggacgccaa ggaacgcgag gaactggcga tggtggtgga cgaggagctg       720
     aagatgctcg ccgaggtggg cgacctcggc ggccgggtcc gcgggccgtt cctgaaggag       780
     atggcgaacc tcgcacacac ggagtactac atcgaggcgc gcacgacgat ggacccgcgc       840
     ctgatcctgc gcaccacgat gttcgccccc accgccaccg gctccccgat ccgcaacgcg       900
     ttccgcgtga tcaagcgcca cgaacgcggc ggacgcggct actacgcggg cgtcgcggcg       960
     ctgatcggcc gcgacgaggc gggcgcgccg acgatggacg cgccgctgct gctgcgcgtg      1020
     gcgtacgtgg agaacgacgg gacggtgcgc gtgccggtcg gcgcgacgct ggtgcgcggg      1080
     tccgatccgt acgaggaggt gcgggagacg tacgcgaagg ccgcgggggt gctgcgggcc      1140
     ttcggggtgg ggttcggcgc gcgcggcggg ttggcggtcg ggacggaggt ggcgccgctc      1200
     ggcgggtcgg atgccgccgc tgcttctgtt acgcctgcac ccctgtctgc gcctgatgcc      1260
     acgccgatcc gcaccacacc gtggtccgag gacccggaga tcgcagccct cctgtccgca      1320
     cgcaacgaat ccctgtccgg cttctggctg aacgagcacg agccggcgga cctcgtcgac      1380
     ccacaactgg ccggtcgcaa ggtcctgatc gtcgacaacg aggacgcctt cacctcgatg      1440
     ctggccgtgg aactccgcgc cctcggcctg gagacaaccc gcgtatccca cgacgaagtc      1500
     cccgaccaca ccacctacga cctggtcctc ctcggccccg gccccggcga cccccgcgat      1560
     acagcgtcgc cccgcatgac cagcgtccgc accctcgcca aactcctcat cgaccaccgc      1620
     gtccccaccc tcggcctctg cctaggccac gaggcactag ccgccgccct cggcctggaa      1680
     ctggtccgcc tcccaacccc aatgcaaggc acgcaggtag agctggacct cttcggcacc      1740
     acagaacgcg tcgccttcta caactcctac gcggcccgca agccagaatt cctagtcctc      1800
     gacacagtcc tcctacccgg caccaccctg acagccgccc tccgaggccc ctccttcacc      1860
     ggcctccaat tccaccccga atccgtggtg accatggacg gcctcggcat cctcagccgc      1920
     gaaatccgcc gcctcctcac ccgttga                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page