(data stored in ACNUC7421 zone)

EMBL: CP001700.PE238

CP001700.PE238       Location/Qualifiers
FT   CDS_pept        270018..271001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0240"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: sma:SAV_4226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69193"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ51"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACU69193.1"
FT                   /translation="MGKKSSRTAKAGPAKAVDGEIPVVGAREACPCGSGRRYKACHGRE
FT                   AAAAAHQQAAEVTANKRPFEGLPGEADIVAMRELVPAATAPLKLAGEHADRTVTLATVL
FT                   PMAAPAVHRDTGEIMLALQTLATSGDPDRDLADALLRALDSAPGTVVDSAAPAADGPRL
FT                   RDLLDTSGDSLGITVHEDFSFWIIDGADVSPEAQLSLEHANAAAYPTKKLESVPSAYWT
FT                   RIREKGHLRWVMPHEEEKLMDALARLHAAKQSNLGEGTRYVGAFRACGLVVPVWDLPKE
FT                   MEAAEIEKPAAEFAERLAKALTDDSPLTNDQRRARAGLVSRQVTLR"
     atgggtaaga agtcgagcag gaccgcgaag gccgggcccg cgaaggctgt ggacggcgag        60
     atcccggtcg tcggcgcgcg cgaggcgtgc ccgtgcggct ccgggcgccg ctacaaggcc       120
     tgtcacggac gcgaggccgc agcggcggcg caccagcagg ccgccgaggt gaccgccaac       180
     aagcggccct tcgaggggct gccgggcgag gccgacatcg tggcgatgcg cgagctggtc       240
     ccggccgcca ccgcgccgct gaagctggcc ggcgagcacg ccgaccgcac cgtcaccctg       300
     gccaccgtgc tgccgatggc cgccccggcg gtgcaccgcg acaccggcga gatcatgctg       360
     gcgctccaga ccctggccac ctccggcgac ccggaccgcg acctggccga cgccctgctg       420
     cgcgccctgg acagcgcgcc gggcacggtc gtggactccg ctgcaccggc ggcggacgga       480
     ccgcgtctgc gcgacctgct ggacaccagc ggggacagcc tgggcatcac cgtccacgag       540
     gacttctcct tctggatcat cgacggcgcg gacgtctcgc cggaggcgca gctctccctg       600
     gagcacgcca acgccgccgc gtacccgacc aagaagctgg agtccgtccc ctcggcgtac       660
     tggacgcgca tccgcgagaa gggccacctg cgctgggtga tgccgcacga ggaggagaag       720
     ctgatggacg cgctggcgcg cctgcacgcc gccaagcagt ccaacctcgg cgagggcacc       780
     cgctacgtcg gtgccttccg cgcctgcggc ctggtcgtcc ccgtctggga tctccctaag       840
     gagatggagg ccgcggagat cgagaagccg gcagcggagt tcgcggagcg tctcgccaag       900
     gcgctcaccg acgacagccc gctgacgaac gatcagcgcc gggcgcgcgc cggtctggtg       960
     agccgacagg tgacgcttcg ctaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page