(data stored in ACNUC7421 zone)

EMBL: CP001700.PE239

CP001700.PE239       Location/Qualifiers
FT   CDS_pept        complement(271124..272263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69194"
FT                   /db_xref="GOA:C7QJ52"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69194.1"
FT                   /translation="MAGMALSRTVRPRALALLPAVAAGGAALVGAGLPTSAAAAAAAAS
FT                   HAAASTLITVTVDSVPALSLNAFQGSYATSTLAQNAGDGSADGAQDPNGVLDRITLDQP
FT                   TQSKIHSDPAKNWADAQPAVEYTLHGKKLYAVSSVDAHAECTPSGQGVNTYVHTAPNSV
FT                   TVLGTNVGAGKTTMAVTGAQLGVAGVDHGSLDVSYTTTATQGQQAAGTSARAHMDLTIS
FT                   GVFYDSQGKQLYSGQLQKLRLGDVQVACQNSGTTTPAPTPTTAVTVASSSGGSVDGVGD
FT                   PTAPGPAAPSTLKGEPDPAAYMRSPHQAGQNGQVRGNAKDEMGPAVPENGPVLPAENAA
FT                   KSSTSGGSDGSLWWALLSVLGLGGGTALYFATRRRGRHQ"
     atggccggca tggcactttc acgcacggtc cggccgcgcg ccctggccct gctcccggcc        60
     gtcgccgcgg gcggggcggc cctggtcggc gcgggcctgc cgacctccgc ggcggccgcc       120
     gccgcagccg cgtcccacgc ggccgccagc acgctgatca cggtgacggt ggacagcgtc       180
     ccggcgttgt ctctcaacgc cttccagggc tcgtacgcga ccagcactct ggcgcagaac       240
     gccggcgacg gctccgcgga cggcgcgcag gacccgaacg gcgtcctcga ccggatcacc       300
     ctggatcagc cgacgcagtc caagattcac tcggacccgg cgaagaactg ggccgacgca       360
     cagcccgcgg tcgagtacac gctccatggg aagaagctct atgcggtctc ctctgtggac       420
     gcgcatgccg agtgcactcc gtcgggacag ggagtgaata cgtatgtgca caccgctccg       480
     aactccgtga cggtgctcgg gacgaacgtc ggggctggta agaccacgat ggcggtgacc       540
     ggagcgcagc tcggggtcgc cggcgtggat cacgggagtc ttgatgtctc gtacacgacg       600
     acggctacgc aggggcagca ggctgcgggc acgtccgcgc gtgcgcatat ggacctgacg       660
     atcagtgggg tcttctatga cagccagggg aagcagctct atagcggaca gctgcagaag       720
     ctgcgcttgg gtgacgtgca ggtggcgtgt cagaactcgg ggacgactac gccggcgcct       780
     actccgacca ctgcggtgac agtcgcgtct tcgtccggag gctctgtcga tggcgtcggt       840
     gacccgacgg ctccgggtcc cgcagcgccg tcaacgctta agggcgagcc tgacccggcg       900
     gcttatatgc gctccccgca tcaggcgggc cagaacggac aggtgcgggg taacgctaag       960
     gacgagatgg gaccggctgt gccggagaac ggaccggtgc ttcctgcgga gaacgccgct      1020
     aagagttcga cgtcgggcgg tagtgacggt tcgctgtggt gggcgctgct gtcagtgctc      1080
     ggactcggcg gggggactgc gttgtatttc gctacgcgac ggcgtgggcg gcatcagtag      1140
//

If you have problems or comments...

PBIL Back to PBIL home page