(data stored in ACNUC7421 zone)

EMBL: CP001700.PE24

CP001700.PE24        Location/Qualifiers
FT   CDS_pept        24904..26529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0024"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO5516 integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68979"
FT                   /db_xref="GOA:C7QFP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU68979.1"
FT                   /translation="MTTTQNPGTAPAPRAGRKEWIGLAVLVLPCLLISMDMSVLLFGLP
FT                   FISASLKPSATQQLWIMDAYGFALAGLLITMGAVGDRIGRRRLLLIGATAFGAASVVAA
FT                   YSGSAEVLIGTRALLGVAGATLMPSTMALIRNMFHDPKQRQTAISLWTGGLIGGVTLGP
FT                   IVGGALLNHFWWGSVFLINLPAMALLLILGPLLLPEYKAPADGRRFDVLGSVLSMAAVF
FT                   PAVYGIKQLAVDGFSATAAGSLAFGIALAVAFVLRQHTAKNPLIDMELFRKPAFRAPML
FT                   VNLCGNFVLMGFSLFNTQYLQSVAGMRPFTAALWSMAAMPFVSVGMGVTGALTTKVRPG
FT                   RIIGVAFLVSSAGALVLTLAHPGNPIVVLLIGAGIAAGGVVAAQSIVGNMVMAAAPAER
FT                   AGSASALNETGAELGSSLGMALLGSVGAAIYHHKMQTVGASGAPDAAVRAGHETIGGAD
FT                   ALAAQFPGPATHALLTTARDAYASGLHTAAGVGAVVLFLTALFAFRALRNEPVLPAAPK
FT                   KEKGTKSKDAMPAEISPDYAAQAV"
     atgacgacga ctcagaaccc tggaaccgcc cccgctccgc gggccggccg caaggagtgg        60
     atcggcctgg ccgtcctggt cctgccgtgc ctgctcatct cgatggacat gtcggtcctg       120
     ctgttcgggc tgccgttcat cagcgcgtcc ctcaagccca gcgccaccca gcagctgtgg       180
     atcatggacg cctacgggtt cgccctggcg ggcctgctga tcaccatggg agccgtcggc       240
     gaccgcatcg gccggcgccg gctgctcctg atcggcgcga cagcgttcgg tgcggcgtcg       300
     gtcgtcgccg cctactccgg aagcgcggag gtgctgatcg gtacccgggc gctgctcggt       360
     gtggccggcg cgacgctgat gccctcgacg atggccttga tccgcaacat gttccacgac       420
     cccaagcagc ggcagaccgc catctcgctg tggaccggcg gcctgatcgg cggcgtgacc       480
     ctgggcccga tcgtcggcgg ggcgctgctg aaccacttct ggtggggctc ggtttttctg       540
     atcaacctgc cggcgatggc gctgctgctg atcctgggcc cgctgctgct gccggagtac       600
     aaggcgcccg ccgacggccg ccggttcgac gtcctgggat cggtgctgtc gatggccgcg       660
     gtcttcccgg cggtgtacgg catcaagcag ctggccgtgg acggtttcag cgccaccgcc       720
     gccgggtcgc tggcgttcgg catagcactc gccgtcgcct tcgtgttgcg gcagcacacc       780
     gcgaagaacc cgctgatcga catggagctc ttccgcaagc cggccttccg ggcgccgatg       840
     ctggtgaacc tgtgcggcaa cttcgtcctg atgggcttca gcctgttcaa cacgcagtat       900
     ctgcagtcgg tggccgggat gcggccgttc accgcggcgc tgtggtcgat ggctgcgatg       960
     ccgttcgtca gcgtcggcat gggagtcacc ggcgcgctga ccaccaaggt ccgtcccggg      1020
     cggatcatcg gcgtggcgtt cctggtctcc tcggccggtg cgctggtgct gaccttggca      1080
     cacccgggta accccatcgt ggtgctgctg atcggcgcgg gtatcgcggc cgggggtgtc      1140
     gtggcggcgc agagcatcgt cgggaacatg gtgatggccg cggctccggc cgagcgggcc      1200
     ggttcggcct cggcgctgaa cgagaccggt gcggaactgg gcagctcgtt gggcatggcg      1260
     ctgctgggca gcgtcggcgc cgcgatctac caccacaaga tgcagaccgt cggcgcctcg      1320
     ggtgctccgg acgcggcggt gcgggcgggc cacgagacga tcggcggcgc ggacgccctg      1380
     gccgcgcagt tccccggccc ggccacccac gcgctgctga cgacggcgcg cgacgcctac      1440
     gcctcgggtc tgcacaccgc ggccggggtc ggggctgtgg tgctgttcct caccgcgctg      1500
     ttcgccttcc gggcgctgcg caatgagccg gtgctgccgg cggcgccgaa gaaggagaag      1560
     ggcacgaaga gcaaggacgc gatgccggcc gagatctcgc ccgactatgc cgcccaggcg      1620
     gtgtga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page