(data stored in ACNUC7421 zone)

EMBL: CP001700.PE240

CP001700.PE240       Location/Qualifiers
FT   CDS_pept        complement(272436..273062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0242"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_0659
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69195"
FT                   /db_xref="GOA:C7QJ53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ53"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69195.1"
FT                   /translation="MDASRHSDDKILDAAQSALLDLGLRNTTLAEVARRAGASRMTLYR
FT                   RYPDIDALLTEVLGRQLIRVVRRNAGLQELAGGGRSARDLLVTGTVEVVRAFHGDLLMH
FT                   KILESDAEFLLPYMTREFGPLQHYALDLLSMRLEQGHEDTSIRHGSVALQARTVLLTAQ
FT                   SFVISARAAGSVPMDRLLEELREMLDAYLRPSADGAQAPDPEPAV"
     atggacgcca gccgacacag cgacgacaag atcctggacg ccgcgcagag cgcgctgttg        60
     gatctgggac tgcgcaacac cacgctcgcc gaggtggcac ggcgggcggg cgcgtcccgg       120
     atgaccttgt accggcgcta tcccgacatc gacgccctgc tcaccgaggt gctggggcgc       180
     cagctgatcc gggtggtacg gcgcaacgcc gggctgcagg agctggccgg cggcggccgc       240
     agcgcccgcg acctgctggt caccgggacc gtcgaggtgg tgcgggcgtt ccacggcgac       300
     ctgctgatgc acaagatcct ggagtccgac gccgagttcc tgctgcccta catgacccgc       360
     gagttcgggc cgctccagca ctacgcgctg gacctgctgt cgatgcggct ggagcaaggg       420
     cacgaagaca cctcgatccg gcacgggtcg gtcgctctgc aggcgcggac ggtgctgctg       480
     acggcgcagt cgttcgtgat ctcggcgcgc gccgccggtt cggtgccgat ggaccggttg       540
     ctggaggagc tccgcgagat gctggacgcg tatctgcggc cgagcgcgga cggcgcgcag       600
     gcaccggatc cggagcccgc cgtgtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page