(data stored in ACNUC7421 zone)

EMBL: CP001700.PE241

CP001700.PE241       Location/Qualifiers
FT   CDS_pept        273093..273794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0243"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   kra:Krad_0170 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69196"
FT                   /db_xref="GOA:C7QJ54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ54"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU69196.1"
FT                   /translation="MEAEPVTEVTSSDVFVIIPAWNEQERIAATVRAAAALGPVLVMDD
FT                   GSRDATTRIARRAGARVLTTRNNLGKGAAMAAGVAALPQQARYVLFLDADLEDTASQAG
FT                   PLVDAVRSGSCDMAIALPPPQPGGGHGLVVGLAREGIKRLTGFDAAAPLSGQRCLTREA
FT                   AEAVRYAARFGVEVGLTIDLLRAGYEVAEVPADLRHRVTGEDWRSQIHRARQYRDVLLA
FT                   LRSRSLPPRSP"
     atggaggcgg aacctgtcac ggaggtcaca tcgagtgacg tcttcgtcat catcccggca        60
     tggaacgaac aggagcggat cgccgccacc gtgcgcgccg ccgccgcgct gggaccggtg       120
     ctggtcatgg acgacggctc ccgcgacgcg accacgcgca tcgcgcgccg cgccggcgcc       180
     agagtcctga ccacgcggaa caacctcggc aagggcgccg cgatggccgc cggcgtcgcc       240
     gcgctcccgc agcaggcgcg ctacgtcctg ttcctggacg ccgacctcga agacaccgcg       300
     tcccaggccg gaccgctcgt cgacgccgtc cgctccggca gctgcgacat ggcgatcgcg       360
     ctcccgccgc cgcagcccgg cggcggccac ggtctggtcg tcggtctggc ccgggaggga       420
     atcaaaaggc tgacgggctt cgacgccgcc gctccgctgt ccgggcagcg ctgcctgacc       480
     cgcgaggcgg cggaagcggt ccgctacgcc gcgcgcttcg gcgtcgaggt cggcctcacc       540
     atcgacctgc tccgggccgg ctacgaggtc gctgaagtcc ccgcggacct ccggcaccgc       600
     gtcaccggcg aggactggcg gtcccagatc caccgggccc gccagtaccg cgacgtcctg       660
     ctggcgctca gatcacgatc cctgccgccc cggagtccgt ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page