(data stored in ACNUC7421 zone)

EMBL: CP001700.PE242

CP001700.PE242       Location/Qualifiers
FT   CDS_pept        complement(273760..274083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0244"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: sma:SAV_4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69197"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ55"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACU69197.1"
FT                   /translation="MLATTDVNALPEGGLLLDVREDDEWAAGHAPTAQHIPMSEFAARK
FT                   DELGTPEGPVYVICRAGSRSAQVAQYLSQNGVEAVNVTGGMQAWEAAGKAVVTDSGAAG
FT                   IVI"
     atgctggcca cgaccgacgt gaacgcactg cccgagggcg gcctgctgct cgacgtccgc        60
     gaggacgacg agtgggcggc cgggcacgcg ccgaccgcgc agcacatccc gatgtcggag       120
     ttcgcggcgc gcaaggacga gctgggcacg cccgagggcc cggtctatgt gatctgccgc       180
     gccggaagcc gctcggcaca ggtggcgcag tacctgagcc agaacggcgt ggaagcagtc       240
     aacgtgaccg gcgggatgca ggcgtgggag gccgcgggca aggcggtcgt cacggactcc       300
     ggggcggcag ggatcgtgat ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page