(data stored in ACNUC7421 zone)

EMBL: CP001700.PE243

CP001700.PE243       Location/Qualifiers
FT   CDS_pept        274186..275463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0245"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: sco:SCO3961 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69198"
FT                   /db_xref="GOA:C7QJ56"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ56"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACU69198.1"
FT                   /translation="MIDLRLLRTDPERVRASQRARGEDPALVDALLSADEARRAAVSRF
FT                   DTLRNEQKVLGKQIPKAAGEEKAALLEQAKKLADGVKAAEADQHEADDVLKQLQLSLSN
FT                   VVIDGVPEGGEDDFVLRETVGTPRDFAADGFEPRDHVELGKLLGAIDLERGVKVGGARQ
FT                   YYLTGVGALLEIALLNMAMAQATTYGFTPMITPSLVKPEAMAGTGFLGQAAENVYHLTE
FT                   DDMYLVGTSEVPLAAYHMDEILDAAKLPLRYAGYSSCYRREAGSYGKDTRGIIRVHQFE
FT                   KVEMFSYVLPEEAEAEHLRLLGWEKEFLTALEIPFRVIDVAAGDLGSSAARKYDCEAWI
FT                   PTQGKYREVTSTSNCTEFQARRLQIRMRGADGVKPLATLNGTLCAMTRMIVAILENHQN
FT                   ADGSVTVPAALRPYLGGREKLEPVAG"
     atgattgacc tgcgactcct gcgcacagac ccggagcgtg tccgcgcctc gcagcgcgcc        60
     cgaggtgaag atccggccct cgtcgacgcg ctgctgtccg cggacgaggc gcgccgcgct       120
     gccgtctccc gcttcgacac gctgcgcaac gagcagaagg tgctcggcaa gcagatcccg       180
     aaggccgcgg gcgaggagaa ggccgcgctg ctcgagcagg ccaagaagct cgccgacggc       240
     gtgaaggcgg ccgaggccga ccagcacgag gccgacgacg tgctcaagca gctccagctc       300
     tcgctgtcga acgtggtcat cgacggcgtg cccgagggcg gcgaggacga cttcgtcctg       360
     cgcgagaccg tcgggacccc gcgcgacttc gccgccgacg gcttcgagcc gcgcgaccac       420
     gtcgagctgg gcaagctgct cggcgcgatc gacctggagc gcggcgtgaa ggtcggcggc       480
     gcgcggcagt actacctgac cggcgtcggc gcgctgctgg agatcgcgct gctgaacatg       540
     gcgatggcgc aggcgaccac gtacggcttc accccgatga tcaccccgtc gctggtgaag       600
     ccggaggcga tggccggcac cggattcctg ggccaggccg ccgagaacgt ctaccacctg       660
     accgaagacg acatgtacct ggtcggcacc tcggaggtgc cgctggcggc gtaccacatg       720
     gacgagatcc tggacgccgc caaactgccg ctgcgctacg ccggctactc gtcgtgctac       780
     cgccgcgagg ccggcagcta cggcaaggac acccgcggca tcatccgggt gcaccagttc       840
     gagaaggtcg agatgttctc ctacgtcctg cccgaggagg ccgaggccga gcacctgcgc       900
     ctgctgggct gggagaagga gttcctcacc gcgctggaga tccccttccg ggtgatcgac       960
     gtcgcggccg gcgacctggg cagctcggcg gcccgcaagt acgactgcga ggcctggatc      1020
     cccactcagg gcaagtaccg cgaggtcacc tcgacctcga actgcaccga gttccaggcc      1080
     cgccgcctgc agatccggat gcgtggcgcc gacggcgtga agccgctggc gacgctgaac      1140
     ggcacgctgt gcgcgatgac ccggatgatc gtggcgatcc tggagaacca ccagaacgcc      1200
     gacggctcgg tgacggttcc ggcggcgctg cggccctacc tcggcggacg cgagaagctg      1260
     gagcccgtcg cgggctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page