(data stored in ACNUC7421 zone)

EMBL: CP001700.PE244

CP001700.PE244       Location/Qualifiers
FT   CDS_pept        complement(275522..276583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69199"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69199.1"
FT                   /translation="METENPDTGRMHQLFGAALDDVDLTGDVVPNVLTGYAHKVKVRRY
FT                   QGAGVAVAALAAAGIAVNVLPHGTGGAPPTTSSATPVQQSPDYCQHQQWVRVSAGVVVQ
FT                   NGNVPLAIPLSPDPRADQASCDALQKALHAVFPEARLIPAFNPDLTRDPRLDQARVRTI
FT                   EMEETTDPNKWSADLTKYFGSELTRLAAHPEDPVNVYMPGQYTLVTPGVRESFGVAFVT
FT                   AAPVANAPESFVGSVGSEDCEKMPAALKDKDQCTSVGVSAGWHGALWNTPAQGVNAPEQ
FT                   TVVLTNGSGTRFQLNAHGTDDSARGIAPSGNALTDEQWARLVASPALQKYADDYFGKAP
FT                   VVPHSTPSPTHSR"
     atggaaactg aaaaccctga caccggaagg atgcaccagc tcttcggcgc cgcactcgac        60
     gatgtcgatc tgaccggaga cgtcgtgccc aacgtcctga ccggctacgc gcacaaggtc       120
     aaggtccggc ggtaccaggg cgccggcgtc gcggtggccg cgctggcggc ggccgggatc       180
     gcggtcaatg tgctgccgca cgggaccggc ggcgcgccgc ccacgacatc gtcggcgacg       240
     ccggtgcagc agagccctga ttactgtcag caccagcagt gggtccgtgt gagcgcaggg       300
     gtcgtcgtgc agaacgggaa cgtcccgctg gccatcccgc tgtccccgga tccgagggcc       360
     gaccaggcga gctgtgacgc cctgcagaag gcactgcacg cggtgttccc cgaagcacgg       420
     ctgatcccgg cgttcaaccc cgacctcacc cgcgacccgc gtctggacca ggctcgggtg       480
     agaacgatcg agatggagga gaccaccgat ccgaacaagt ggtccgccga tctgacgaag       540
     tacttcggct ccgagctgac gcgcctggcg gcccatcctg aggacccggt gaacgtctac       600
     atgcccggtc agtacacgct ggtcacgccc ggcgtccggg aatcgttcgg ggtcgccttc       660
     gtcaccgccg cgcccgtcgc gaacgcgccc gaatcgttcg tgggatcggt cggctccgag       720
     gactgcgaga agatgcccgc ggctttgaag gacaaggatc agtgcacgtc cgtcggtgtc       780
     tccgccggct ggcacggagc gctgtggaac actcccgcgc aaggcgtcaa cgccccggag       840
     cagaccgtcg tcctgaccaa cggttccggg acacgcttcc agctcaacgc tcacggaacc       900
     gatgactcgg caaggggaat cgcaccctcc gggaacgcgc tgaccgatga gcagtgggcc       960
     cggctggtcg cgtccccggc gctccagaag tacgcggacg actacttcgg caaggcgccg      1020
     gtcgtgccgc attcgacgcc cagcccgacc cacagccgct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page