(data stored in ACNUC7421 zone)

EMBL: CP001700.PE245

CP001700.PE245       Location/Qualifiers
FT   CDS_pept        complement(276573..277136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0247"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sgr:SGR_2995 RNA
FT                   polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69200"
FT                   /db_xref="GOA:C7QJ58"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ58"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69200.1"
FT                   /translation="MIGRLTQEELADFTAFAQARQRHLMRTAFLLSGNRQSAQDLTQTA
FT                   LLDLCRSWRRVRRADDVDAYAHRVLINAFRTSARRSDRERKALWRKASEAAGSPADGAA
FT                   PDQSVGMRLSLLAALDRLPPKARAVVVLRYWEDLSVEATAAALGCSTGTVKSQSSRALA
FT                   RLRALLGDGFATTDSEHWEISYGN"
     gtgataggca ggctcaccca agaggagctc gcggacttca ccgcgttcgc ccaggcccgg        60
     caacgccacc tgatgcggac ggcgttcctg ctgagcggca accgccaatc cgcgcaggac       120
     ctgacccaga cggcgctgct cgacctgtgc cgcagctggc gccgggtacg gcgcgccgac       180
     gacgtggacg cctacgccca ccgggtcctg atcaacgcct tccggacctc ggcacgtagg       240
     tcggaccgag agcgcaaagc cttgtggcgc aaggcttccg aagctgccgg gtcgccggcc       300
     gacggcgcgg cgccggacca gtccgtgggc atgcggctgt cgctgctggc agcgctggac       360
     cggctgccgc cgaaggcgcg cgccgtcgtc gtcctgcggt actgggagga cctcagcgtg       420
     gaggcgacgg ccgccgcgct cgggtgctcg accggcaccg tcaagagcca gtcctcgcgc       480
     gccctggcca ggctgcgcgc gctgctcggc gacgggttcg ccaccactga ttccgagcac       540
     tgggagatct cgtatggaaa ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page