(data stored in ACNUC7421 zone)

EMBL: CP001700.PE246

CP001700.PE246       Location/Qualifiers
FT   CDS_pept        complement(277219..278541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0248"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_1492 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69201"
FT                   /db_xref="GOA:C7QJ59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ59"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69201.1"
FT                   /translation="MRTIINRDFTRLWYGEAVSEVGDYVFNTTLVLWIATKLGNGKSWA
FT                   PVAVSGVLLSGLAATLAIAPAAGVFADRWNRKRTMLRMDAIRAVAVGGLAALAFLPAGK
FT                   LPVGVWLAIIYAVVFVINAAGTFFGPSRMAVIPDVVGGPDEIARASGITQSTAALAGMI
FT                   GPPLAAPLLFAGGVQWAMLINALSYVVSFTAIRPVPIPGNAPSPAAKAESGFWSEFRAV
FT                   LAFFAKTRVLVVLIISACIANFGAQAMNTLDVFFATRNLHAAPKLYGLLGMAIGAGAII
FT                   GALLSTRVVRRIGTVNAVWATIGTAGVLIVAYSRQTSIWAAIPVIFLASLPIAMVNTAM
FT                   EPLLIQVTPRAMLGRVFSVITPAISVTQLGSTILFGWMISSLMLHFHADVAGLHVGPID
FT                   TLFTVTGLLFVVAAIYAFVMLPRKDGVPAAEPDDEGELALV"
     atgaggacca tcatcaaccg ggatttcacc cggctctggt acggggaagc cgtttccgag        60
     gtcggggact acgtcttcaa tacgacgctg gtcctgtgga tagccacaaa gctggggaac       120
     ggcaaaagct gggcaccggt cgcggtctcc ggcgtgctgc tctcgggatt ggcagcgacc       180
     ttggccatcg cccctgccgc cggggtcttc gccgatcgat ggaaccgcaa acgcaccatg       240
     ttgcgcatgg acgcgatccg ggccgtcgcg gtcggcggcc tcgccgcgct cgccttcctg       300
     ccggccggca agcttccggt cggcgtctgg ctcgcgatca tctacgctgt ggtcttcgtc       360
     atcaacgcgg cggggacctt cttcggtccc tcgcgcatgg ccgtcatccc cgacgtggtc       420
     ggcggtcccg acgagatcgc gcgggcctcg ggcatcacgc agtccaccgc cgcgctcgcc       480
     gggatgatcg gaccgccgct ggccgcgccg ctgttgttcg ccggcggcgt gcagtgggcg       540
     atgctcatca atgctctgtc ttacgtggtg tccttcaccg cgatccggcc ggttccgatc       600
     ccgggcaacg ccccgagccc ggcagccaag gccgaatcag ggttctggtc cgagttcagg       660
     gccgtgctcg cgttcttcgc caagacccgg gtcctggtcg tcctcatcat ctcggcgtgc       720
     atcgccaact tcggcgccca ggccatgaac acgctcgacg tcttcttcgc gacccggaac       780
     ctgcacgcgg cgcccaagct ctacggcctg ctcggcatgg ccatcggcgc cggagccatc       840
     atcggcgcgc tgctgtccac ccgcgtcgtg cggcggatcg gcacggtcaa cgcggtctgg       900
     gcgacgatcg ggacggcggg cgttctcatc gtcgcctact cccggcagac ctcgatctgg       960
     gccgcgatcc cggtcatctt cctggcctcg ctgccgatcg ccatggtcaa caccgccatg      1020
     gaaccgctgc tcatccaggt cacgccgcga gcgatgctgg gccgcgtgtt ctcggtgatc      1080
     acgccggcca tcagcgtcac gcagctcggc tcgacgatcc tgttcggctg gatgatcagc      1140
     tcgctcatgc tccacttcca cgccgacgtg gccgggctgc acgtgggacc gatcgacacc      1200
     ctgttcacgg tcaccggtct gctgttcgtc gtcgccgcga tctacgcctt cgtcatgctg      1260
     ccgcgcaagg acggcgtccc cgccgccgaa ccggacgacg aaggcgaact cgctctcgtc      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page