(data stored in ACNUC7421 zone)

EMBL: CP001700.PE247

CP001700.PE247       Location/Qualifiers
FT   CDS_pept        278772..280166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0249"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69202"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ60"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69202.1"
FT                   /translation="MKRRTSSLLTAIALVSGAAASTLAVAPAQAATDSGTCASGSEKQG
FT                   PISFNPSAAVAPATIGIRVAANTIDAANGCKAVLDFGDGTSTALSTDADVAHTYTNPGD
FT                   YRVTLTLQWPGYSPAVESGHLLIGGAAGQAQITRIAGADRLDTAVQISQKQWLTVDPKS
FT                   SWGQAQTAVIATSGTFPDALAGGPLAAYKRGPLLLTPPNAGLYGAANDEINRVVPKGRT
FT                   IFILGGYAAVSASVDQQLITEGYKVQRFAGQTRFDTALQVAKFGLGDPANVVVATGTDF
FT                   PDALSAGPLAAGPRATEVAGQAPQPAAIILTNGAKFFDPSTSAYVKGKLGTANCNAVTA
FT                   VGGAAVHALGALAGGLCHSELSGADRYATSAKVFGEFSLTYLVGVASGTTFADALTGAA
FT                   YVANVQQPLLLTDPTHLPDPIGAYFDAMGKQAGISYVDVFGGPKAITDHVYGQIADAAH
FT                   SGEYNP"
     atgaaacgca gaacatccag cctgctcacc gccatcgcgc tggtgtcggg agcggccgcc        60
     tcgacgctgg cggtcgcgcc ggcgcaggcc gcgaccgact ccgggacgtg cgcctcgggc       120
     tccgagaagc agggtccgat cagcttcaac ccgtctgccg cggtggctcc cgcgaccatc       180
     gggatccgcg tcgccgccaa caccatcgac gcggcgaacg gctgcaaggc tgtgttggac       240
     ttcggcgacg gcacgtccac ggcgctgtcg accgacgcgg acgtggcgca cacgtacacc       300
     aaccccggcg actaccgggt cactttgacg ctgcagtggc cgggctactc cccggccgtc       360
     gagagcggcc acctgctgat cgggggcgct gccgggcagg cgcagatcac gcggatcgcc       420
     ggcgcggacc ggctggacac cgcggtgcag atctcgcaga agcagtggct cacggtcgat       480
     ccgaagagca gctggggtca ggcgcagacg gcggtcatcg cgacctccgg taccttcccc       540
     gacgccctcg ccggcgggcc gctggccgcg tacaagcgcg gtccgttgct gctgaccccg       600
     ccgaacgcgg gtctgtacgg cgcggccaac gacgagatca accgggtcgt gccgaagggc       660
     cgcaccatct tcatcctcgg cgggtacgcc gcggtgtcgg cctcggtcga ccagcagctg       720
     atcaccgagg gctacaaggt ccagcgcttc gccggccaga cccgcttcga caccgcgctg       780
     caggtcgcga agttcggcct gggcgacccg gcgaacgtgg tcgtcgccac cggcaccgac       840
     ttcccggacg ccctgtccgc cggtccgctg gccgccggtc cccgcgccac cgaggtcgcc       900
     ggccaggcgc cgcagccggc cgcgatcatc ctgaccaacg gcgcgaagtt cttcgacccg       960
     agcacctcgg cgtacgtcaa gggcaagctc ggcacggcga actgcaacgc ggtgactgct      1020
     gttggtggcg ctgcggtgca cgcgttgggc gcgctggccg gcggcctgtg ccacagcgag      1080
     ctgtccggcg ccgaccggta cgcgacctcc gcgaaggtgt tcggcgagtt ctcactgacc      1140
     tacctcgtcg gcgtggccag cggcacgacc ttcgccgacg ccctgaccgg cgccgcgtac      1200
     gtggcgaacg tgcagcagcc gctgctgctg accgacccga cccacctgcc cgaccccatc      1260
     ggcgcctact tcgacgccat gggcaagcag gccgggatct cctacgtcga cgtcttcggc      1320
     ggcccgaagg cgatcaccga ccacgtgtac gggcagatcg cggacgcggc gcacagcggg      1380
     gagtacaacc cgtga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page