(data stored in ACNUC7421 zone)

EMBL: CP001700.PE248

CP001700.PE248       Location/Qualifiers
FT   CDS_pept        complement(280193..281374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0250"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: saq:Sare_0997 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69203"
FT                   /db_xref="GOA:C7QJ61"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ61"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ACU69203.1"
FT                   /translation="MGSSVTSTLLTGIAELTTHADSGGLADSTVADAAMVVVDGRVAWT
FT                   GPGAGAPDADERVELGGRAVIPGFVDSHAHLVFAGDRAQEFAARMTGAPYSAGGIRTTV
FT                   AATRGASDDVLRSNLRRLVGEMLRQGTTTVECKSGYGLTVEDEARALRLAREQVEAVTY
FT                   LGAHVVPAEYKDRAGEYVDLVKGPMLDACAPYADFADVFCERGAFDEEQTREILTAARA
FT                   KGLDLRLHANQLGNGPGVQLAVEFGAASADHCTFLDDKDIDALAGSQTIATLLPGVEFS
FT                   TRSPYPDARRLLDAGATVAIATDCNPGSCYTNSMPFCIAVAVRDMHMSPAEALWAATVG
FT                   GAKALRRDDVGHLGVGARADFAVLDAPSYLHLAYRPGVPLVHRVWKNGTPVAG"
     atgggaagca gcgtgaccag tactctcctc accggcattg ccgagctcac tactcacgcc        60
     gattccggtg gcttggccga ctcgaccgtt gccgatgccg ccatggtcgt tgttgatggg       120
     cgggttgcgt ggacgggtcc gggggcgggg gctccggatg ctgatgagcg cgtggagctt       180
     ggggggcggg cggtgattcc tgggttcgtt gacagccatg ctcatctggt gtttgccggg       240
     gatcgggcgc aggagtttgc tgcgcggatg actggggcgc cgtacagtgc cggcgggatt       300
     cgtacgactg tcgctgccac gcgtggtgcg tcggatgatg tgctgcgcag taatctgcgg       360
     cggcttgtcg gggagatgtt gcggcagggg acgacgaccg ttgagtgcaa gtcggggtat       420
     gggctcacgg ttgaggatga ggcgcgggcg ttgcggctgg cgcgtgagca ggtcgaggcg       480
     gtgacgtacc tcggtgcgca tgttgtgccg gccgagtaca aggatcgggc tggggagtac       540
     gtcgatctgg tcaagggtcc gatgctagat gcctgtgcgc cgtatgccga cttcgccgat       600
     gtgttctgcg agcgcggggc gttcgatgag gagcagacgc gcgagattct gaccgctgct       660
     cgggccaagg ggctggatct gcggttgcat gccaaccagc tcggcaatgg gcctggcgtg       720
     cagctcgctg tcgagttcgg cgcggcgtcg gcggatcact gcacgttcct ggacgacaag       780
     gacatcgacg cgttggctgg atcacagact attgcgacgc tgctgccggg ggtggagttc       840
     tcgacgcgct cgccgtaccc ggacgcgcgc cggctgctgg atgccggggc gaccgtcgcc       900
     atcgccactg actgcaaccc agggtcctgc tacacgaatt cgatgccgtt ctgcatcgcc       960
     gtggcggtca gggacatgca catgtcgccg gccgaggcgc tgtgggccgc gacagtcggt      1020
     ggggcaaagg cactgcgccg cgatgatgtc ggccacctgg gcgtcggtgc ccgcgcggac      1080
     ttcgctgtgc tggacgcgcc gagctatctc cacctcgcct atcggccggg cgtcccgctt      1140
     gtccacaggg tgtggaaaaa cgggacgccg gtcgccgggt ag                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page