(data stored in ACNUC7421 zone)

EMBL: CP001700.PE249

CP001700.PE249       Location/Qualifiers
FT   CDS_pept        complement(281646..283079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0251"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: sma:SAV_3494 N-formimino-L-glutamate
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69204"
FT                   /db_xref="GOA:C7QJ62"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ62"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ACU69204.1"
FT                   /translation="MTSSENPQTATTIPATTPSPNGGAASAGADRRAFWCELAWINGEI
FT                   KSKVLIEVAGGQISAVTCGVKPRPQNAEKLTGLTIPGLANVHSHAFHRALRGRTQIESG
FT                   TFWTWRERMYAAAAHLDPDSYRELATAVFAEMALAGVTAVGEFHYVHHSPKGGLYQDPN
FT                   AMGHALTEAAEAAGIRITLLDTCYLSGGFDNELNDVQRRFSDGDAGRWAERVEALRKAY
FT                   AGSDTVRIGAAVHSVRAVPVDQLSPVVAFAAENEMPLHVHLSEQRAENDACLARHHKTP
FT                   TELLHAHGALGPRTTAVHATHLSQMDIDLLGTSATAVCMCPTTERDLADGIGPAHAVHL
FT                   AGSPVNLGTDSHAMIDLFEEARAVELDERLRTERRGHWLASELLQAATTDGHASLGWPT
FT                   TGRLQPGTPADFTTIALDTVRLAGVQPAHAAESVIFAATAADVRHVVVAGKFTVRDHQH
FT                   MLVDDVPGRLAATIGAIFK"
     gtgacttcct ccgagaaccc gcagaccgcg accacgatcc cggccactac tccctccccg        60
     aacggcggcg ccgccagcgc cggcgccgac cggcgcgcgt tctggtgcga actcgcctgg       120
     atcaacggcg agatcaagag caaggtcctc atcgaggtcg ccggcgggca gatctccgcg       180
     gtcacctgcg gcgtgaaacc ccgcccccag aacgccgaga aactgaccgg cctgaccatc       240
     ccgggcctgg cgaacgtcca ctcccacgcc ttccaccgag ccctgcgcgg ccgcacccag       300
     atcgagtccg gcaccttctg gacctggcgc gaacgcatgt acgccgccgc cgcgcacctg       360
     gacccggact cctaccgcga actggccacc gcggtcttcg cggagatggc actggccggc       420
     gtcacagccg tcggggagtt ccactacgta caccactcgc ccaagggcgg cctgtatcag       480
     gacccgaacg ccatgggcca cgccctgacc gaggccgccg aggccgcggg catccgcatc       540
     accctgctgg acacgtgcta cctgtccggc ggcttcgaca acgaactgaa cgacgtccag       600
     cggcgcttct ccgacggcga cgccggccgc tgggccgaac gcgtcgaggc actccgcaag       660
     gcttatgcgg gctctgacac ggtacgcatc ggcgcggcgg tgcacagcgt ccgcgccgtc       720
     cccgtcgatc agctctcccc ggtggtggcc ttcgcggcgg agaacgaaat gcccctgcac       780
     gtccacctgt ccgagcagcg cgcggagaac gacgcctgcc tggcccgcca ccacaagacc       840
     cccaccgaac tcctgcacgc ccacggcgcc ctcggcccgc gcaccaccgc cgtccacgcc       900
     acacacctgt cccaaatgga catcgacctc ctcggcacct ccgccacggc ggtctgcatg       960
     tgccccacca ccgaacgcga cctggccgac ggcatcggcc cagcccacgc agtccacctc      1020
     gcaggctccc ccgtcaacct gggcaccgac tcccacgcca tgatcgacct cttcgaagaa      1080
     gcccgagccg tagaactcga cgaacgcctc cgcaccgaac gccgaggcca ctggctagcc      1140
     tccgaactcc tccaagccgc caccaccgac ggccacgcct ccctaggctg gcccaccaca      1200
     ggccgcctgc aacccggcac ccccgccgac ttcaccacca tcgccctcga caccgtccgc      1260
     ctagccggcg tccaacccgc ccacgccgcc gaatcagtga tcttcgccgc caccgccgcc      1320
     gacgtccgcc acgtcgtggt cgccggtaag ttcacggtcc gcgaccatca gcacatgctg      1380
     gtcgacgacg tgccgggacg cctggccgcg acgatcgggg cgatcttcaa gtag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page