(data stored in ACNUC7421 zone)

EMBL: CP001700.PE25

CP001700.PE25        Location/Qualifiers
FT   CDS_pept        complement(26620..27483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0025"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; KEGG: kpn:KPN_04605 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68980"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP1"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACU68980.1"
FT                   /translation="MTIAITAAGGHLGRLVVEDLLARGVPAGQIRAIVRTPEKVQDFAD
FT                   RGVQVVRGDYADVPGLTEALRGADKWVFISSSGSDEDRLSQHLTAIQAGKAAGVPHVVY
FT                   TSIPKAETNPISFASVHKETEAAIKESGLPHTFLRNNWYWENLTASLPNAIEHGAIIGA
FT                   VGEGLTAFAARADYAAAAAVVATTEGHEGKIYELTGDRAYSYAEIAAEISRQTGKEIAA
FT                   VNLDPEEYRKTLAGFGLPDFLSAGLAHADSKIAEGALADVTSDLSTLIGRPTTTVAEAI
FT                   TDALKA"
     atgaccatcg ccatcaccgc cgccggcggc cacctcggcc ggctcgtcgt cgaggacctg        60
     ctggcgcgcg gcgtcccggc ggggcagatc cgcgccatcg tgcgcacccc ggagaaggtc       120
     caggacttcg ccgaccgcgg ggtgcaggtg gtccgaggcg actacgccga cgtccccggc       180
     ctgaccgagg cgctgcgcgg cgccgacaag tgggtcttca tctcctccag cggctccgac       240
     gaggaccgct tgagccagca cctgaccgcg atccaggcgg gcaaggcggc cggcgtgccc       300
     cacgtcgtct acacctcgat cccgaaggcc gagaccaacc cgatcagctt cgcctcggtc       360
     cacaaggaga ccgaggccgc gatcaaggag tccggtctgc cgcacacctt cctgcggaac       420
     aactggtact gggagaacct gaccgcgagc ctgccgaacg ccatcgagca cggcgcgatc       480
     atcggcgccg tcggcgaggg cctgaccgcg ttcgccgcgc gggccgacta cgccgccgcg       540
     gccgcggtcg tcgccaccac cgagggccac gagggcaaga tttacgagct caccggcgac       600
     cgcgcctaca gctacgccga gatcgccgcc gagatctcgc gccagaccgg caaggagatc       660
     gcggccgtga acctggaccc cgaggagtac cggaagacgc tggccggctt cggtctgccg       720
     gacttcctgt ccgcgggtct ggcccacgcg gactcaaaga tcgccgaggg cgcgctggcc       780
     gacgtcacca gcgacctcag caccctgatc ggccgcccga ccaccacggt cgccgaggcg       840
     atcacggacg cgctcaaggc ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page